StarFunc result for job id Q15648

User Input

>input (1581 residues)
MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVS
CLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQL
CDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSL
EQDLSKMAIMYWKATNAGPLDKILHGSVGYLTPRSGGHLMNLKYYVSPSDLLDDKTASPI
ILHENNVSRSLGMNASVTIEGTSAVYKLPIAPLIMGSHPVDNKWTPSFSSITSANSVDLP
ACFFLKFPQPIPVSRAFVQKLQNCTGIPLFETQPTYAPLYELITQFELSKDPDPIPLNHN
MRFYAALPGQQHCYFLNKDAPLPDGRSLQGTLVSKITFQHPGRVPLILNLIRHQVAYNTL
IGSCVKRTILKEDSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLY
KGLSDALICTDDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNL
PPASSPGYGMTTGNNPMSGTTTPTNTFPGGPITTLFNMSMSIKDRHESVGHGEDFSKVSQ
NPILTSLLQITGNGGSTIGSSPTPPHHTPPPVSSMAGNTKNHPMLMNLLKDNPAQDFSTL
YGSSPLERQNSSSGSPRMEICSGSNKTKKKKSSRLPPEKPKHQTEDDFQRELFSMDVDSQ
NPIFDVNMTADTLDTPHITPAPSQCSTPPTTYPQPVPHPQPSIQRMVRLSSSDSIGPDVT
DILSDIAEEASKLPSTSDDCPAIGTPLRDSSSSGHSQSTLFDSDVFQTNNNENPYTDPAD
LIADAAGSPSSDSPTNHFFHDGVDFNPDLLNSQSQSGFGEEYFDESSQSGDNDDFKGFAS
QALNTLGVPMLGGDNGETKFKGNNQADTVDFSIISVAGKALAPADLMEHHSGSQGPLLTT
GDLGKEKTQKRVKEGNGTSNSTLSGPGLDSKPGKRSRTPSNDGKSKDKPPKRKKADTEGK
SPSHSSSNRPFTPPTSTGGSKSPGSAGRSQTPPGVATPPIPKITIQIPKGTVMVGKPSSH
SQYTSSGSVSSSGSKSHHSHSSSSSSSASTSGKMKSSKSEGSSSSKLSSSMYSSQGSSGS
SQSKNSSQSGGKPGSSPITKHGLSSGSSSTKMKPQGKPSSLMNPSLSKPNISPSHSRPPG
GSDKLASPMKPVPGTPPSSKAKSPISSGSGGSHMSGTSSSSGMKSSSGLGSSGSLSQKTP
PSSNSCTASSSSFSSSGSSMSSSQNQHGSSKGKSPSRNKKPSLTAVIDKLKHGVVTSGPG
GEDPLDGQMGVSTNSSSHPMSSKHNMSGGEFQGKREKSDKDKSKVSTSGSSVDSSKKTSE
SKNVGSTGVAKIIISKHDGGSPSIKAKVTLQKPGESSGEGLRPQMASSKNYGSPLISGST
PKHERGSPSHSKSPAYTPQNLDSESESGSSIAEKSYQNSPSSDDGIRPLPEYSTEKHKKH
KKEKKKVKDKDRDRDRDKDRDKKKSHSIKPESWSKSPISSDQSLSMTSNTILSADRPSRL
SPDFMIGEEDDDLMDVALIGN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15648	1.000	1.000	0.000	1581	1.000	1.000	Q15648.pdb.gz	MED1_HUMAN Mediator of RNA polymerase II transcription subunit 1 OS=Homo sapiens OX=9606 GN=MED1 PE=1 SV=4
2	PDB:7enaa	0.274	0.867	1.975E-64	469	0.287	0.966	7enaa.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
3	AFDB:Q9VP05	0.288	0.308	5.210E-44	1475	0.195	0.209	Q9VP05.pdb.gz	MED1_DROME Mediator of RNA polymerase II transcription subunit 1 OS=Drosophila melanogaster OX=7227 GN=MED1 PE=1 SV=2
4	AFDB:Q9VU86	0.035	0.031	1.766E-2	1873	0.096	0.081	Q9VU86.pdb.gz	Q9VU86_DROME LD34837p OS=Drosophila melanogaster OX=7227 GN=Spt20 PE=1 SV=3
5	AFDB:Q9C0A6	0.036	0.038	3.568E-2	1442	0.118	0.130	Q9C0A6.pdb.gz	SETD5_HUMAN Histone-lysine N-methyltransferase SETD5 OS=Homo sapiens OX=9606 GN=SETD5 PE=1 SV=2
6	AFDB:Q5JV73	0.051	0.046	5.500E-2	1810	0.143	0.125	Q5JV73.pdb.gz	FRPD3_HUMAN FERM and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FRMPD3 PE=2 SV=2
7	AFDB:Q6P4S6	0.035	0.040	8.477E-2	1311	0.104	0.126	Q6P4S6.pdb.gz	SIK3_MOUSE Serine/threonine-protein kinase SIK3 OS=Mus musculus OX=10090 GN=Sik3 PE=1 SV=4
8	PDB:7nvrl	0.062	0.150	9.775E-2	501	0.032	0.100	7nvrl.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
9	AFDB:P23226	0.030	0.037	1.808E-1	1185	0.108	0.144	P23226.pdb.gz	MA205_DROME 205 kDa microtubule-associated protein OS=Drosophila melanogaster OX=7227 GN=Map205 PE=1 SV=2
10	AFDB:Q24079	0.026	0.032	1.808E-1	1221	0.099	0.129	Q24079.pdb.gz	Q24079_DROME E93 OS=Drosophila melanogaster OX=7227 GN=Eip93F PE=2 SV=1
11	AFDB:O43379	0.036	0.037	1.908E-1	1518	0.073	0.076	O43379.pdb.gz	WDR62_HUMAN WD repeat-containing protein 62 OS=Homo sapiens OX=9606 GN=WDR62 PE=1 SV=4
12	AFDB:Q5T8A7	0.029	0.035	2.786E-1	1209	0.113	0.148	Q5T8A7.pdb.gz	PPR26_HUMAN Protein phosphatase 1 regulatory subunit 26 OS=Homo sapiens OX=9606 GN=PPP1R26 PE=1 SV=1
13	PDB:3tgoD	0.038	0.206	3.392E-1	186	0.008	0.065	3tgoD.pdb.gz
14	PDB:3j92z	0.047	0.346	5.825E-1	130	0.013	0.162	3j92z.pdb.gz	Structure and Assembly Pathway of the Ribosome Quality Control Complex.
15	PDB:6qleO	0.033	0.223	5.825E-1	205	0.005	0.039	6qleO.pdb.gz
16	PDB:7jzvA	0.043	0.183	6.149E-1	253	0.013	0.083	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
17	PDB:3zxuD	0.043	0.226	9.478E-1	198	0.006	0.045	3zxuD.pdb.gz	Rwd Domain: A Recurring Module in Kinetochore Architecture Shown by a Ctf19-Mcm21 Complex Structure.
18	PDB:5ufuA	0.034	0.118	1.056	369	0.005	0.022	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
19	PDB:3zxuA	0.036	0.184	1.177	211	0.010	0.076	3zxuA.pdb.gz	Rwd Domain: A Recurring Module in Kinetochore Architecture Shown by a Ctf19-Mcm21 Complex Structure.
20	PDB:4fhnB	0.029	0.042	1.177	1022	0.011	0.017	4fhnB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A4N6	0.0	1120	590	0.335	0.898	A0A8I6A4N6_RAT Mediator of RNA polymerase II transcription subunit 1 OS=Rattus norvegicus OX=10116 GN=Med1 PE=3 SV=1
2	A0A8I6AC46	0.0	2627	1582	0.939	0.939	A0A8I6AC46_RAT Mediator of RNA polymerase II transcription subunit 1 OS=Rattus norvegicus OX=10116 GN=Med1 PE=1 SV=1
3	D3ZRN2	0.0	2575	1568	0.924	0.932	D3ZRN2_RAT Mediator of RNA polymerase II transcription subunit 1 OS=Rattus norvegicus OX=10116 GN=Med1 PE=1 SV=2
4	Q15648	0.0	3193	1581	1.000	1.000	MED1_HUMAN Mediator of RNA polymerase II transcription subunit 1 OS=Homo sapiens OX=9606 GN=MED1 PE=1 SV=4
5	Q925J9	0.0	2652	1575	0.937	0.941	MED1_MOUSE Mediator of RNA polymerase II transcription subunit 1 OS=Mus musculus OX=10090 GN=Med1 PE=1 SV=2
6	Q9VP05	2.84e-61	234	1475	0.100	0.107	MED1_DROME Mediator of RNA polymerase II transcription subunit 1 OS=Drosophila melanogaster OX=7227 GN=MED1 PE=1 SV=2
7	A0A8I6G510	2.55e-53	183	97	0.056	0.918	A0A8I6G510_RAT Mediator complex subunit 1 OS=Rattus norvegicus OX=10116 GN=Med1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10744 Med1	4e-59	212.4	Mediator of RNA polymerase II transcription subunit 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300651

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287820	0.999	Peroxisome proliferator-activated receptor gamma
2	9606.ENSP00000405330	0.999	Estrogen receptor
3	9606.ENSP00000323720	0.998	Mediator of RNA polymerase II transcription subunit 14
4	9606.ENSP00000363193	0.998	Mediator of RNA polymerase II transcription subunit 12
5	9606.ENSP00000370938	0.997	Cyclin-dependent kinase 8
6	9606.ENSP00000251871	0.996	Mediator of RNA polymerase II transcription subunit 17
7	9606.ENSP00000258648	0.996	Mediator of RNA polymerase II transcription subunit 4
8	9606.ENSP00000380888	0.996	Mediator of RNA polymerase II transcription subunit 13
9	9606.ENSP00000481920	0.996	Mediator of RNA polymerase II transcription subunit 6
10	9606.ENSP00000297347	0.995	Mediator of RNA polymerase II transcription subunit 30
11	9606.ENSP00000362948	0.995	Mediator of RNA polymerase II transcription subunit 18
12	9606.ENSP00000263390	0.994	Mediator of RNA polymerase II transcription subunit 26
13	9606.ENSP00000290663	0.994	Mediator of RNA polymerase II transcription subunit 8
14	9606.ENSP00000357047	0.994	Mediator of RNA polymerase II transcription subunit 23
15	9606.ENSP00000377686	0.994	Mediator of RNA polymerase II transcription subunit 24
16	9606.ENSP00000419692	0.994	Retinoic acid receptor RXR-alpha
17	9606.ENSP00000325612	0.993	Mediator of RNA polymerase II transcription subunit 16
18	9606.ENSP00000263205	0.992	Mediator of RNA polymerase II transcription subunit 15
19	9606.ENSP00000314343	0.992	Mediator of RNA polymerase II transcription subunit 29
20	9606.ENSP00000482438	0.992	Mediator of RNA polymerase II transcription subunit 22

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0140296	1.000	general transcription initiation factor binding
GO:0042975	1.000	peroxisome proliferator activated receptor binding
GO:0035035	1.000	histone acetyltransferase binding
GO:0046966	1.000	nuclear thyroid hormone receptor binding
GO:0042809	1.000	nuclear vitamin D receptor binding
GO:0031490	1.000	chromatin DNA binding
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0061630	0.999	ubiquitin protein ligase activity
GO:0003713	0.998	transcription coactivator activity
GO:0042974	0.938	nuclear retinoic acid receptor binding
GO:0001221	0.934	transcription coregulator binding
GO:0030331	0.926	nuclear estrogen receptor binding
GO:0019904	0.925	protein domain specific binding
GO:0030374	0.923	nuclear receptor coactivator activity
GO:0001223	0.913	transcription coactivator binding
GO:0050693	0.654	LBD domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0071704	0.994	organic substance metabolic process
GO:0009987	0.993	cellular process
GO:0044238	0.993	primary metabolic process
GO:0006355	0.986	regulation of DNA-templated transcription
GO:0006807	0.982	nitrogen compound metabolic process
GO:0048522	0.980	positive regulation of cellular process
GO:0009893	0.976	positive regulation of metabolic process
GO:0050896	0.975	response to stimulus
GO:0006357	0.970	regulation of transcription by RNA polymerase II
GO:0010604	0.962	positive regulation of macromolecule metabolic process
GO:0043170	0.957	macromolecule metabolic process
GO:0051716	0.955	cellular response to stimulus
GO:0051173	0.946	positive regulation of nitrogen compound metabolic process
GO:0031325	0.946	positive regulation of cellular metabolic process
GO:1901564	0.941	organonitrogen compound metabolic process
GO:0032501	0.940	multicellular organismal process
GO:0031328	0.927	positive regulation of cellular biosynthetic process
GO:0010557	0.910	positive regulation of macromolecule biosynthetic process
GO:0032502	0.909	developmental process
GO:0042221	0.907	response to chemical
GO:0051254	0.906	positive regulation of RNA metabolic process
GO:0010033	0.898	response to organic substance
GO:0070887	0.891	cellular response to chemical stimulus
GO:0045893	0.890	positive regulation of DNA-templated transcription
GO:0045944	0.883	positive regulation of transcription by RNA polymerase II
GO:0048523	0.879	negative regulation of cellular process
GO:0071310	0.869	cellular response to organic substance
GO:1901360	0.866	organic cyclic compound metabolic process
GO:0007154	0.854	cell communication
GO:0043412	0.847	macromolecule modification
GO:0019538	0.836	protein metabolic process
GO:0048856	0.833	anatomical structure development
GO:0036211	0.822	protein modification process
GO:0071495	0.821	cellular response to endogenous stimulus
GO:0044237	0.807	cellular metabolic process
GO:0007275	0.806	multicellular organism development
GO:0009725	0.786	response to hormone
GO:1901576	0.736	organic substance biosynthetic process
GO:0023052	0.726	signaling
GO:0007165	0.720	signal transduction
GO:0016567	0.658	protein ubiquitination
GO:1901362	0.654	organic cyclic compound biosynthetic process
GO:0048731	0.643	system development
GO:0032870	0.641	cellular response to hormone stimulus
GO:0060322	0.639	head development
GO:0007417	0.615	central nervous system development
GO:0097066	0.595	response to thyroid hormone
GO:0048513	0.536	animal organ development
GO:0034641	0.447	cellular nitrogen compound metabolic process
GO:0065008	0.384	regulation of biological quality
GO:0009892	0.368	negative regulation of metabolic process
GO:0050793	0.365	regulation of developmental process
GO:0048583	0.360	regulation of response to stimulus
GO:0010605	0.339	negative regulation of macromolecule metabolic process
GO:0007420	0.326	brain development
GO:0006139	0.317	nucleobase-containing compound metabolic process
GO:0044249	0.306	cellular biosynthetic process
GO:0002682	0.302	regulation of immune system process
GO:0045595	0.300	regulation of cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0140513	0.998	nuclear protein-containing complex
GO:0090575	0.967	RNA polymerase II transcription regulator complex
GO:0016592	0.962	mediator complex
GO:0016020	0.948	membrane
GO:1902494	0.934	catalytic complex
GO:0005694	0.931	chromosome
GO:0005737	0.755	cytoplasm
GO:1990234	0.750	transferase complex
GO:0000785	0.747	chromatin
GO:0140535	0.728	intracellular protein-containing complex
GO:0000151	0.675	ubiquitin ligase complex
GO:0070847	0.515	core mediator complex
GO:0005730	0.386	nucleolus
GO:0032993	0.381	protein-DNA complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]