StarFunc result for job id Q15649

User Input

>input (155 residues)
MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTK
TVKPVENKDDDDSIADFLNSDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNLDQG
EDKAKLMRAYMQEPLFVEFADCCLGIVEPSQNEES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15649	1.000	1.000	1.172E-25	155	1.000	1.000	Q15649.pdb.gz	ZNHI3_HUMAN Zinc finger HIT domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZNHIT3 PE=1 SV=2
2	AFDB:Q7ZUF9	0.510	0.521	5.280E-13	151	0.465	0.477	Q7ZUF9.pdb.gz	Q7ZUF9_DANRE Zgc:56688 OS=Danio rerio OX=7955 GN=zgc:56688 PE=2 SV=1
3	AFDB:Q386M1	0.379	0.305	1.520E-5	194	0.245	0.196	Q386M1.pdb.gz	Q386M1_TRYB2 HIT-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0420 PE=4 SV=1
4	AFDB:P46973	0.299	0.284	1.150E-4	164	0.194	0.183	P46973.pdb.gz	HIT1_YEAST Protein HIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HIT1 PE=1 SV=1
5	AFDB:Q9BXT4	0.218	0.035	1.042E-1	1180	0.142	0.019	Q9BXT4.pdb.gz	TDRD1_HUMAN Tudor domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TDRD1 PE=1 SV=2
6	AFDB:Q58EK5	0.233	0.039	2.313E-1	1175	0.116	0.015	Q58EK5.pdb.gz	TDRD1_DANRE Tudor domain-containing protein 1 OS=Danio rerio OX=7955 GN=tdrd1 PE=1 SV=2
7	AFDB:Q8T3N7	0.200	0.041	4.017E-1	892	0.110	0.019	Q8T3N7.pdb.gz	Q8T3N7_DROME GM03859p OS=Drosophila melanogaster OX=7227 GN=Kots PE=2 SV=1
8	AFDB:F4I642	0.247	0.051	4.541E-1	928	0.123	0.020	F4I642.pdb.gz	F4I642_ARATH Ubiquitin-specific protease 15 OS=Arabidopsis thaliana OX=3702 GN=UBP15 PE=1 SV=1
9	AFDB:Q381Z7	0.124	0.070	6.976E-1	341	0.142	0.065	Q381Z7.pdb.gz	Q381Z7_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6000 PE=4 SV=1
10	PDB:5v3hA	0.187	0.072	7.069E-1	438	0.071	0.025	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
11	AFDB:Q9SB51	0.214	0.041	8.916E-1	1008	0.129	0.020	Q9SB51.pdb.gz	UBP16_ARATH Ubiquitin carboxyl-terminal hydrolase 16 OS=Arabidopsis thaliana OX=3702 GN=UBP16 PE=1 SV=1
12	PDB:7z0sG	0.238	0.165	9.606E-1	250	0.148	0.092	7z0sG.pdb.gz	Structure of the membrane-bound formate hydrogenlyase complex from Escherichia coli.
13	PDB:5o85D	0.173	0.410	1.668	53	0.052	0.151	5o85D.pdb.gz	The intricate network between the p34 and p44 subunits is central to the activity of the transcription/DNA repair factor TFIIH.
14	PDB:6gejS	0.225	0.169	2.411	208	0.084	0.062	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
15	PDB:3n71A	0.179	0.062	2.898	468	0.058	0.019	3n71A.pdb.gz	Crystal Structure of Cardiac-specific Histone Methyltransferase SmyD1 Reveals Unusual Active Site Architecture.
16	PDB:6htsR	0.239	0.477	3.081	72	0.058	0.125	6htsR.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
17	PDB:7zs96	0.192	0.091	3.081	383	0.084	0.034	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
18	PDB:4v6wCW	0.145	0.170	4.733	130	0.116	0.138	4v6wCW.pdb.gz	Structures of the human and Drosophila 80S ribosome.
19	PDB:7mq8LJ	0.138	0.062	6.050	469	0.116	0.038	7mq8LJ.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:7zsb4	0.085	0.054	6.050	306	0.077	0.039	7zsb4.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15649	3.62e-112	316	155	1.000	1.000	ZNHI3_HUMAN Zinc finger HIT domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZNHIT3 PE=1 SV=2
2	Q7ZUF9	4.44e-42	139	151	0.471	0.483	Q7ZUF9_DANRE Zgc:56688 OS=Danio rerio OX=7955 GN=zgc:56688 PE=2 SV=1
3	O36031	1.78e-05	44.3	154	0.271	0.273	YEKJ_SCHPO Uncharacterized zinc-finger protein C4F10.19c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4F10.19c PE=4 SV=1
4	Q384S0	0.002	39.7	599	0.110	0.028	Q384S0_TRYB2 HIT-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.5350 PE=4 SV=1
5	Q386M1	0.011	37.0	194	0.090	0.072	Q386M1_TRYB2 HIT-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0420 PE=4 SV=1
6	P46973	0.034	35.4	164	0.174	0.165	HIT1_YEAST Protein HIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HIT1 PE=1 SV=1
7	P38772	0.041	35.8	366	0.123	0.052	BCD1_YEAST Box C/D snoRNA protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BCD1 PE=1 SV=1
8	Q9UHR6	0.070	35.0	403	0.071	0.027	ZNHI2_HUMAN Zinc finger HIT domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZNHIT2 PE=1 SV=1
9	Q23644	0.19	33.9	455	0.097	0.033	Q23644_CAEEL HIT-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=zhit-3 PE=1 SV=2
10	H7C3G0	0.27	33.1	264	0.206	0.121	H7C3G0_HUMAN RBR-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=RNF144A PE=1 SV=1
11	P50876	0.30	33.1	292	0.206	0.110	R144A_HUMAN E3 ubiquitin-protein ligase RNF144A OS=Homo sapiens OX=9606 GN=RNF144A PE=1 SV=2
12	Q9NWK9	0.78	32.0	470	0.116	0.038	BCD1_HUMAN Box C/D snoRNA protein 1 OS=Homo sapiens OX=9606 GN=ZNHIT6 PE=1 SV=1
13	Q9M1E4	1.5	31.2	989	0.129	0.020	Q9M1E4_ARATH RNA binding (RRM/RBD/RNP motifs) family protein OS=Arabidopsis thaliana OX=3702 GN=F9K21.210 PE=1 SV=1
14	A9CPT4	1.7	31.2	1133	0.103	0.014	TDRD1_ORYLA Tudor domain-containing protein 1 OS=Oryzias latipes OX=8090 GN=tdrd1 PE=2 SV=1
15	Q8VE98	1.7	30.8	316	0.110	0.054	CD276_MOUSE CD276 antigen OS=Mus musculus OX=10090 GN=Cd276 PE=1 SV=1
16	Q9VCU7	2.2	30.8	691	0.110	0.025	VRET_DROME Protein vreteno OS=Drosophila melanogaster OX=7227 GN=vret PE=1 SV=1
17	Q9VZ41	2.4	30.4	532	0.123	0.036	Q9VZ41_DROME SET and MYND domain containing, arthropod-specific, member 4, isoform A OS=Drosophila melanogaster OX=7227 GN=SmydA-4 PE=4 SV=2
18	Q8SWU5	3.2	30.0	403	0.123	0.047	Q8SWU5_DROME RE25548p OS=Drosophila melanogaster OX=7227 GN=SmydA-4 PE=2 SV=1
19	Q8IR97	3.3	30.0	403	0.123	0.047	Q8IR97_DROME SET and MYND domain containing, arthropod-specific, member 4, isoform B OS=Drosophila melanogaster OX=7227 GN=SmydA-4 PE=4 SV=1
20	Q5BN24	3.5	30.0	1363	0.129	0.015	Q5BN24_DANRE GLI family zinc finger 2b OS=Danio rerio OX=7955 GN=gli2b PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02782 FGGY_C	4.1e+02	12.2	FGGY family of carbohydrate kinases, C-terminal domain
2	PF04438 zf-HIT	1.9e-05	35.7	HIT zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000484687

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368459	0.999	Nuclear fragile X mental retardation-interacting protein 1
2	9606.ENSP00000359606	0.961	Box C/D snoRNA protein 1
3	9606.ENSP00000264279	0.931	Nucleolar protein 58
4	9606.ENSP00000262265	0.886	PIH1 domain-containing protein 1
5	9606.ENSP00000383949	0.877	NHP2-like protein 1
6	9606.ENSP00000370589	0.807	Nucleolar protein 56
7	9606.ENSP00000318297	0.781	RuvB-like 1
8	9606.ENSP00000261435	0.724	NEDD4-binding protein 2
9	9606.ENSP00000432768	0.724	Cytoskeleton-associated protein 5
10	9606.ENSP00000324122	0.710	U4/U6 small nuclear ribonucleoprotein Prp31
11	9606.ENSP00000304229	0.702	Histidine triad nucleotide-binding protein 1
12	9606.ENSP00000347719	0.693	Tubulin-specific chaperone D
13	9606.ENSP00000304593	0.692	Zinc finger HIT domain-containing protein 1
14	9606.ENSP00000308548	0.683	Zinc finger HIT-type containing 2
15	9606.ENSP00000379904	0.675	Thyroid hormone receptor beta
16	9606.ENSP00000478220	0.665	Gametogenetin-binding protein 2
17	9606.ENSP00000005386	0.664	RNA polymerase II-associated protein 3
18	9606.ENSP00000351737	0.663	Complex I assembly factor TMEM126B, mitochondrial
19	9606.ENSP00000287820	0.661	Peroxisome proliferator-activated receptor gamma
20	9606.ENSP00000352271	0.661	DNA repair protein XRCC2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046966	1.000	nuclear thyroid hormone receptor binding
GO:0097159	0.343	organic cyclic compound binding
GO:1901363	0.342	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010556	0.985	regulation of macromolecule biosynthetic process
GO:0031326	0.985	regulation of cellular biosynthetic process
GO:0051252	0.985	regulation of RNA metabolic process
GO:0006355	0.983	regulation of DNA-templated transcription
GO:0009987	0.420	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0031981	0.969	nuclear lumen
GO:0005654	0.964	nucleoplasm
GO:0005829	0.695	cytosol
GO:0032991	0.453	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]