StarFunc result for job id Q15651

User Input

>input (99 residues)
MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGA
KGKKEEKQEAGKEGTAPSENGETKAEEAQKTESVDNEGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15651	0.999	0.999	8.183E-16	99	1.000	1.000	Q15651.pdb.gz	HMGN3_HUMAN High mobility group nucleosome-binding domain-containing protein 3 OS=Homo sapiens OX=9606 GN=HMGN3 PE=1 SV=2
2	AFDB:A0A087WZE9	0.211	0.174	6.027E-9	130	0.899	0.685	A0A087WZE9.pdb.gz	A0A087WZE9_HUMAN High mobility group nucleosomal binding domain 3 OS=Homo sapiens OX=9606 GN=HMGN3 PE=1 SV=1
3	AFDB:O00479	0.329	0.353	9.441E-4	90	0.465	0.511	O00479.pdb.gz	HMGN4_HUMAN High mobility group nucleosome-binding domain-containing protein 4 OS=Homo sapiens OX=9606 GN=HMGN4 PE=1 SV=3
4	AFDB:P82970	0.107	0.085	4.021	282	0.323	0.113	P82970.pdb.gz	HMGN5_HUMAN High mobility group nucleosome-binding domain-containing protein 5 OS=Homo sapiens OX=9606 GN=HMGN5 PE=1 SV=1
5	AFDB:Q6DR46	0.178	0.114	9.123	184	0.091	0.049	Q6DR46.pdb.gz	Q6DR46_ARATH AGAMOUS-like 41 OS=Arabidopsis thaliana OX=3702 GN=AGL41 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15651	5.99e-61	182	99	1.000	1.000	HMGN3_HUMAN High mobility group nucleosome-binding domain-containing protein 3 OS=Homo sapiens OX=9606 GN=HMGN3 PE=1 SV=2
2	Q9DCB1	7.12e-53	162	99	0.869	0.869	HMGN3_MOUSE High mobility group nucleosome-binding domain-containing protein 3 OS=Mus musculus OX=10090 GN=Hmgn3 PE=1 SV=1
3	A0A087WZE9	9.27e-44	140	130	1.000	0.762	A0A087WZE9_HUMAN High mobility group nucleosomal binding domain 3 OS=Homo sapiens OX=9606 GN=HMGN3 PE=1 SV=1
4	P02313	2.51e-08	49.3	90	0.515	0.567	HMGN2_BOVIN Non-histone chromosomal protein HMG-17 OS=Bos taurus OX=9913 GN=HMGN2 PE=1 SV=2
5	P18608	3.14e-08	48.9	96	0.434	0.448	HMGN1_MOUSE Non-histone chromosomal protein HMG-14 OS=Mus musculus OX=10090 GN=Hmgn1 PE=1 SV=2
6	P05204	6.68e-08	48.1	90	0.515	0.567	HMGN2_HUMAN Non-histone chromosomal protein HMG-17 OS=Homo sapiens OX=9606 GN=HMGN2 PE=1 SV=3
7	P09602	1.12e-06	45.1	90	0.495	0.544	HMGN2_MOUSE Non-histone chromosomal protein HMG-17 OS=Mus musculus OX=10090 GN=Hmgn2 PE=1 SV=2
8	Q5JSL0	1.55e-06	45.8	148	0.394	0.264	Q5JSL0_HUMAN High mobility group nucleosome binding domain 5 (Fragment) OS=Homo sapiens OX=9606 GN=HMGN5 PE=1 SV=1
9	O00479	3.67e-06	43.5	90	0.505	0.556	HMGN4_HUMAN High mobility group nucleosome-binding domain-containing protein 4 OS=Homo sapiens OX=9606 GN=HMGN4 PE=1 SV=3
10	P82970	1.92e-05	43.5	282	0.242	0.085	HMGN5_HUMAN High mobility group nucleosome-binding domain-containing protein 5 OS=Homo sapiens OX=9606 GN=HMGN5 PE=1 SV=1
11	P18437	3.89e-05	40.8	90	0.465	0.511	HMGN2_RAT Non-histone chromosomal protein HMG-17 OS=Rattus norvegicus OX=10116 GN=Hmgn2 PE=1 SV=2
12	Q9JL35	1.31e-04	41.2	406	0.232	0.057	HMGN5_MOUSE High mobility group nucleosome-binding domain-containing protein 5 OS=Mus musculus OX=10090 GN=Hmgn5 PE=1 SV=2
13	P05114	4.87e-04	38.1	100	0.384	0.380	HMGN1_HUMAN Non-histone chromosomal protein HMG-14 OS=Homo sapiens OX=9606 GN=HMGN1 PE=1 SV=3
14	Q5JSK6	6.14e-04	38.9	161	0.323	0.199	Q5JSK6_HUMAN High mobility group nucleosome binding domain 5 (Fragment) OS=Homo sapiens OX=9606 GN=HMGN5 PE=1 SV=1
15	A6NEL0	0.003	36.6	116	0.333	0.284	A6NEL0_HUMAN High mobility group nucleosome binding domain 1 OS=Homo sapiens OX=9606 GN=HMGN1 PE=1 SV=1
16	Q56A10	0.81	30.4	1511	0.293	0.019	ZN608_MOUSE Zinc finger protein 608 OS=Mus musculus OX=10090 GN=Znf608 PE=1 SV=1
17	O70507	1.1	30.0	1186	0.212	0.018	HCN4_MOUSE Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4 OS=Mus musculus OX=10090 GN=Hcn4 PE=1 SV=2
18	O42269	1.4	30.0	3121	0.202	0.006	O42269_DANRE Huntingtin OS=Danio rerio OX=7955 GN=HD PE=1 SV=3
19	Q61762	2.4	29.3	602	0.162	0.027	KCNA5_MOUSE Potassium voltage-gated channel subfamily A member 5 OS=Mus musculus OX=10090 GN=Kcna5 PE=1 SV=2
20	P02315	4.4	27.3	70	0.182	0.257	H6_ONCMY Non-histone chromosomal protein H6 OS=Oncorhynchus mykiss OX=8022 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01101 HMG14_17	3.4e-22	90.6	HMG14 and HMG17

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000031392

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000045332	0.540	High mobility group nucleosome binding domain 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	0.999	chromatin binding
GO:1901363	0.823	heterocyclic compound binding
GO:0097159	0.823	organic cyclic compound binding
GO:0003676	0.804	nucleic acid binding
GO:0003677	0.514	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006355	0.989	regulation of DNA-templated transcription
GO:0009987	0.987	cellular process
GO:0008152	0.978	metabolic process
GO:0044237	0.972	cellular metabolic process
GO:0071704	0.936	organic substance metabolic process
GO:0006807	0.920	nitrogen compound metabolic process
GO:0006357	0.897	regulation of transcription by RNA polymerase II
GO:0090087	0.895	regulation of peptide transport
GO:0050708	0.895	regulation of protein secretion
GO:0023051	0.862	regulation of signaling
GO:0010646	0.862	regulation of cell communication
GO:0006725	0.803	cellular aromatic compound metabolic process
GO:0002791	0.792	regulation of peptide secretion
GO:0046883	0.792	regulation of hormone secretion
GO:0090276	0.775	regulation of peptide hormone secretion
GO:0046483	0.754	heterocycle metabolic process
GO:0044238	0.724	primary metabolic process
GO:0048518	0.722	positive regulation of biological process
GO:0043170	0.703	macromolecule metabolic process
GO:0034641	0.694	cellular nitrogen compound metabolic process
GO:0010604	0.556	positive regulation of macromolecule metabolic process
GO:0050796	0.549	regulation of insulin secretion
GO:0048522	0.543	positive regulation of cellular process
GO:1901360	0.485	organic cyclic compound metabolic process
GO:0006139	0.470	nucleobase-containing compound metabolic process
GO:0045935	0.435	positive regulation of nucleobase-containing compound metabolic process
GO:0050896	0.364	response to stimulus
GO:0090304	0.363	nucleic acid metabolic process
GO:0045893	0.360	positive regulation of DNA-templated transcription
GO:0044093	0.358	positive regulation of molecular function
GO:0061178	0.349	regulation of insulin secretion involved in cellular response to glucose stimulus
GO:0048519	0.341	negative regulation of biological process
GO:1901576	0.332	organic substance biosynthetic process
GO:0048523	0.321	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0005737	0.969	cytoplasm
GO:0005829	0.499	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]