StarFunc result for job id Q15652

User Input

>input (2540 residues)
MAVETRAELVGKRFLCVAVGDEARSERWESGRGWRSWRAGVIRAVSHRDSRNPDLAVYVE
FDDLEWDKREWVKVYEDFSTFLVEYHLIWAKRNDPSQTQGSKSKQIQWPALTFKPLVERN
IPSSVTAVEFLVDKQLDFLTEDSAFQPYQDDIDSLNPVLRDNPQLHEEVKVWVKEQKVQE
IFMQGPYSLNGYRVRVYRQDSATQWFTGIITHHDLFTRTMIVMNDQVLEPQNVDPSMVQM
TFLDDVVHSLLKGENIGITSRRRSRANQNVNAVHSHYTRAQANSPRPAMNSQAAVPKQNT
HQQQQQRSIRPNKRKGSDSSIPDEEKMKEEKYDYISRGENPKGKNKHLMNKRRKPEEDEK
KLNMKRLRTDNVSDFSESSDSENSNKRIIDNSSEQKPENELKNKNTSKINGEEGKPHNNE
KAGEETLKNSQPPWDQIQEDKKHEEAEKRKSVDTQLQEDMIIHSSEQSTVSDHNSNDLLP
QECNMDKTHTMELLPKEKFVSRPPTPKCVIDITNDTNLEKVAQENSSTFGLQTLQKMDPN
VSDSKHSIANAKFLETAKKDSDQSWVSDVVKVDLTQSSVTNASSGNDHLNMEKEKYVSYI
SPLSAVSVMEDKLHKRSPPPETIKSKLNTSVDTHKIKSSPSPEVVKPKITHSPDSVKSKA
TYVNSQATGERRLANKIEHELSRCSFHPIPTRSSTLETTKSPLIIDKNEHFTVYRDPALI
GSETGANHISPFLSQHPFPLHSSSHRTCLNPGTHHPALTPAPHLLAGSSSQTPLPTINTH
PLTSGPHHAVHHPHLLPTVLPGVPTASLLGGHPRLESAHASSLSHLALAHQQQQQLLQHQ
SPHLLGQAHPSASYNQLGLYPIIWQYPNGTHAYSGLGLPSSKWVHPENAVNAEASLRRNS
PSPWLHQPTPVTSADGIGLLSHIPVRPSSAEPHRPLKITAHSSPPLTKTLVDHHKEELER
KAFMEPLRSVASTSAKNDLDLNRSQTGKDCHLHRHFVDPVLNQLQRPPQETGERLNKYKE
EHRRILQESIDVAPFTTKIKGLEGERENYSRVASSSSSPKSHIIKQDMDVERSVSDLYKM
KHSVPQSLPQSNYFTTLSNSVVNEPPRSYPSKEVSNIYGDKQSNALAAAAANPQTLTSFI
TSLSKPPPLIKHQPESEGLVGKIPEHLPHQIASHSVTTFRNDCRSPTHLTVSSTNTLRSM
PALHRAPVFHPPIHHSLERKEGSYSSLSPPTLTPVMPVNAGGKVQESQKPPTLIPEPKDS
QANFKSSSEQSLTEMWRPNNNLSKEKTEWHVEKSSGKLQAAMASVIVRPSSSTKTDSMPA
MQLASKDRVSERSSAGAHKTDCLKLAEAGETGRIILPNVNSDSVHTKSEKNFQAVSQGSV
PSSVMSAVNTMCNTKTDVITSAADTTSVSSWGGSEVISSLSNTILASTSSECVSSKSVSQ
PVAQKQECKVSTTAPVTLASSKTGSVVQPSSGFSGTTDFIHLKKHKAALAAAQYKSSNAS
ETEPNAIKNQTLSASLPLDSTVICSTINKANSVGNGQASQTSQPNYHTKLKKAWLTRHSE
EDKNTNKMENSGNSVSEIIKPCSVNLIASTSSDIQNSVDSKIIVDKYVKDDKVNRRKAKR
TYESGSESGDSDESESKSEQRTKRQPKPTYKKKQNDLQKRKGEIEEDLKPNGVLSRSAKE
RSKLKLQSNSNTGIPRSVLKDWRKVKKLKQTGESFLQDDSCCEIGPNLQKCRECRLIRSK
KGEEPAHSPVFCRFYYFRRLSFSKNGVVRIDGFSSPDQYDDEAMSLWTHENFEDDELDIE
TSKYILDIIGDKFCQLVTSEKTALSWVKKDAKIAWKRAVRGVREMCDACEATLFNIHWVC
QKCGFVVCLDCYKAKERKSSRDKELYAWMKCVKGQPHDHKHLMPTQIIPGSVLTDLLDAM
HTLREKYGIKSHCHCTNKQNLQVGNFPTMNGVSQVLQNVLNHSNKISLCMPESQQQNTPP
KSEKNGGSSPESDVGTDNKLTPPESQSPLHWLADLAEQKAREEKKENKELTLENQIKEER
EQDNSESPNGRTSPLVSQNNEQGSTLRDLLTTTAGKLRVGSTDAGIAFAPVYSMGAPSSK
SGRTMPNILDDIIASVVENKIPPSKTSKINVKPELKEEPEESIISAVDENNKLYSDIPHS
WICEKHILWLKDYKNSSNWKLFKECWKQGQPAVVSGVHKKMNISLWKAESISLDFGDHQA
DLLNCKDSIISNANVKEFWDGFEEVSKRQKNKSGETVVLKLKDWPSGEDFKTMMPARYED
LLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVS
DVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVD
KIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVL
PAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELRLLKEEINYDDKLQVKNILYHAV
KEMVRALKIHEDEVEDMEEN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IYD2	0.319	0.317	0.000	2557	0.592	0.588	A0A0R4IYD2.pdb.gz
2	AFDB:Q15652	1.000	1.000	0.000	2540	1.000	1.000	Q15652.pdb.gz	JHD2C_HUMAN Probable JmjC domain-containing histone demethylation protein 2C OS=Homo sapiens OX=9606 GN=JMJD1C PE=1 SV=2
3	AFDB:Q69ZK6	0.370	0.394	0.000	2350	0.795	0.860	Q69ZK6.pdb.gz	JHD2C_MOUSE Probable JmjC domain-containing histone demethylation protein 2C OS=Mus musculus OX=10090 GN=Jmjd1c PE=1 SV=3
4	AFDB:M0RDF1	0.264	0.378	8.938E-91	1724	0.261	0.384	M0RDF1.pdb.gz	M0RDF1_RAT Lysine-specific demethylase OS=Rattus norvegicus OX=10116 GN=Kdm3b PE=1 SV=2
5	PDB:3al5B	0.079	0.548	1.019E-6	311	0.013	0.109	3al5B.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
6	PDB:5nfnB	0.084	0.542	1.623E-6	318	0.018	0.142	5nfnB.pdb.gz	(3S)-Lysyl hydroxylation of TRAFAC GTPases is catalyzed by the human Jumonji-C oxygenase JMJD7.
7	PDB:4qszA	0.076	0.250	9.914E-6	686	0.017	0.061	4qszA.pdb.gz	Crystal structure of mouse JMJd7 fused with maltose-binding protein
8	PDB:3al5C	0.072	0.530	2.515E-5	284	0.015	0.137	3al5C.pdb.gz	Crystal structure of a novel JmjC-domain-containing protein, TYW5, involved in tRNA modification.
9	PDB:7yxgA	0.085	0.552	2.789E-5	313	0.020	0.160	7yxgA.pdb.gz	Conservation of the unusual dimeric JmjC fold of JMJD7 from Drosophila melanogaster to humans.
10	AFDB:E9QG91	0.104	0.148	6.051E-5	1719	0.095	0.140	E9QG91.pdb.gz
11	PDB:2ns2B	0.037	0.255	3.700E-4	172	0.012	0.180	2ns2B.pdb.gz	Structure of human spindlin1. Tandem tudor-like domains for cell cycle regulation
12	PDB:4b7eA	0.079	0.463	3.700E-4	349	0.015	0.109	4b7eA.pdb.gz	Substrate selectivity analyses of factor inhibiting hypoxia-inducible factor.
13	AFDB:O15054	0.096	0.143	7.624E-4	1643	0.095	0.147	O15054.pdb.gz	KDM6B_HUMAN Lysine-specific demethylase 6B OS=Homo sapiens OX=9606 GN=KDM6B PE=1 SV=4
14	AFDB:F1Q6M9	0.040	0.039	1.181E-2	2623	0.116	0.112	F1Q6M9.pdb.gz	F1Q6M9_DANRE Capicua transcriptional repressor b OS=Danio rerio OX=7955 GN=cicb PE=4 SV=2
15	PDB:4bxfA	0.065	0.314	2.200E-2	425	0.015	0.087	4bxfA.pdb.gz	Ribosomal oxygenases are structurally conserved from prokaryotes to humans.
16	AFDB:Q924A2	0.030	0.030	3.499E-2	2510	0.126	0.128	Q924A2.pdb.gz	CIC_MOUSE Protein capicua homolog OS=Mus musculus OX=10090 GN=Cic PE=1 SV=2
17	PDB:7r1dC	0.027	0.263	3.689E-2	192	0.006	0.083	7r1dC.pdb.gz
18	PDB:4xaeA	0.061	0.345	4.777E-2	329	0.013	0.103	4xaeA.pdb.gz
19	AFDB:P35658	0.033	0.037	5.292E-2	2090	0.104	0.126	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
20	AFDB:A2CG63	0.031	0.050	8.004E-2	1314	0.059	0.113	A2CG63.pdb.gz	ARI4B_MOUSE AT-rich interactive domain-containing protein 4B OS=Mus musculus OX=10090 GN=Arid4b PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZXX2	0.0	847	1762	0.169	0.243	A0A8I5ZXX2_RAT Lysine-specific demethylase OS=Rattus norvegicus OX=10116 GN=Kdm3b PE=3 SV=1
2	A0A8I6AC36	0.0	844	1562	0.175	0.284	A0A8I6AC36_RAT Lysine-specific demethylase OS=Rattus norvegicus OX=10116 GN=Kdm3b PE=1 SV=1
3	M0RDF1	0.0	847	1724	0.169	0.249	M0RDF1_RAT Lysine-specific demethylase OS=Rattus norvegicus OX=10116 GN=Kdm3b PE=1 SV=2
4	Q15652	0.0	5263	2540	1.000	1.000	JHD2C_HUMAN Probable JmjC domain-containing histone demethylation protein 2C OS=Homo sapiens OX=9606 GN=JMJD1C PE=1 SV=2
5	Q63679	0.0	764	1214	0.154	0.322	KDM3A_RAT Lysine-specific demethylase 3A OS=Rattus norvegicus OX=10116 GN=Kdm3a PE=2 SV=1
6	Q69ZK6	0.0	4014	2350	0.797	0.861	JHD2C_MOUSE Probable JmjC domain-containing histone demethylation protein 2C OS=Mus musculus OX=10090 GN=Jmjd1c PE=1 SV=3
7	Q6PCM1	0.0	769	1323	0.155	0.297	KDM3A_MOUSE Lysine-specific demethylase 3A OS=Mus musculus OX=10090 GN=Kdm3a PE=1 SV=1
8	Q7LBC6	0.0	859	1761	0.173	0.250	KDM3B_HUMAN Lysine-specific demethylase 3B OS=Homo sapiens OX=9606 GN=KDM3B PE=1 SV=2
9	Q9Y4C1	0.0	768	1321	0.159	0.306	KDM3A_HUMAN Lysine-specific demethylase 3A OS=Homo sapiens OX=9606 GN=KDM3A PE=1 SV=4
10	Q9VHC5	8.23e-111	378	854	0.070	0.208	Q9VHC5_DROME JmjC domain-containing histone demethylase 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Kdm3 PE=2 SV=1
11	Q61645	7.36e-56	217	1182	0.067	0.145	HAIR_MOUSE Lysine-specific demethylase hairless OS=Mus musculus OX=10090 GN=Hr PE=2 SV=2
12	P97609	1.39e-55	216	1181	0.068	0.146	HAIR_RAT Lysine-specific demethylase hairless OS=Rattus norvegicus OX=10116 GN=Hr PE=1 SV=2
13	O43593	2.46e-53	209	1189	0.068	0.145	HAIR_HUMAN Lysine-specific demethylase hairless OS=Homo sapiens OX=9606 GN=HR PE=1 SV=5
14	Q9SSE9	2.43e-45	182	1027	0.053	0.130	JMJ25_ARATH Lysine-specific demethylase JMJ25 OS=Arabidopsis thaliana OX=3702 GN=JMJ25 PE=1 SV=1
15	C0SUU8	1.09e-43	176	875	0.045	0.131	JMJ26_ARATH Lysine-specific demethylase JMJ26 OS=Arabidopsis thaliana OX=3702 GN=JMJ26 PE=2 SV=1
16	C0SV12	5.12e-42	171	883	0.044	0.127	JMJ29_ARATH Lysine-specific demethylase JMJ29 OS=Arabidopsis thaliana OX=3702 GN=JMJ29 PE=2 SV=1
17	F4JFK4	6.30e-40	165	1049	0.052	0.125	F4JFK4_ARATH Transcription factor jumonji (JmjC) domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=IBM1 PE=1 SV=1
18	Q8H1S7	6.46e-24	113	927	0.043	0.117	JMJ28_ARATH Lysine-specific demethylase JMJ28 OS=Arabidopsis thaliana OX=3702 GN=JMJ28 PE=1 SV=1
19	F4HZD1	7.75e-24	112	944	0.041	0.110	JMJ24_ARATH E3 ubiquitin-protein ligase JMJ24 OS=Arabidopsis thaliana OX=3702 GN=JMJ24 PE=1 SV=1
20	Q8VYB9	7.22e-20	99.8	840	0.022	0.067	JMJ27_ARATH Lysine-specific demethylase JMJ27 OS=Arabidopsis thaliana OX=3702 GN=JMJ27 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03107 C1_2	3.1e+02	13.1	C1 domain
2	PF02373 JmjC	8.7e-08	44.0	JmjC domain, hydroxylase
3	PF02928 zf-C5HC2	61	15.4	C5HC2 zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382204

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000159111	0.916	Lysine-specific demethylase 4B
2	9606.ENSP00000282516	0.802	Nipped-B-like protein
3	9606.ENSP00000361473	0.796	Lysine-specific demethylase 4A
4	9606.ENSP00000370710	0.795	Lysine-specific demethylase 4C
5	9606.ENSP00000442382	0.795	Lysine-specific demethylase 4C
6	9606.ENSP00000362863	0.782	Receptor expression-enhancing protein 3
7	9606.ENSP00000363822	0.772	Androgen receptor
8	9606.ENSP00000259915	0.692	POU domain, class 5, transcription factor 1
9	9606.ENSP00000430955	0.681	E3 ubiquitin ligase that catalyzes the direct transfer of ubiquitin from E2 ubiquitin-conjugating enzyme to a specific substrate. In response to bacterial infection, negatively regulates the phagocyte oxidative burst by controlling the turnover of the NADPH oxidase complex subunits. Promotes monoubiquitination of CYBA and 'Lys-48'- linked polyubiquitination and degradation of CYBB NADPH oxidase catalytic subunits, both essential for the generation of antimicrobial reactive oxygen species. Involved in the maintenance of cholesterol homeostasis. In response to high sterol concentrations [...]
10	9606.ENSP00000374390	0.680	Probable G-protein coupled receptor 149
11	9606.ENSP00000355969	0.672	Plays a critical role in the regulation of enzymes involved in nucleotide cycle in photoreceptors (PubMed:29515371, PubMed:21928830, PubMed:21078983, PubMed:27471269, PubMed:30559291). Inhibits the basal catalytic activity and the GCAP-stimulated activity of GUCY2D and GUCY2F, two retinal guanylyl cyclases involved in the production of cGMP in photoreceptors (PubMed:21928830, PubMed:27471269, PubMed:29515371, PubMed:30559291). Involved in the transport of GUCY2D and GUCY2F to their target sites in the photoreceptor outer segment . Up-regulates the activity of GUK1, a kinase that plays [...]
12	9606.ENSP00000216267	0.654	Bromodomain-containing protein 1
13	9606.ENSP00000303148	0.642	Voltage-dependent calcium channel gamma-like subunit
14	9606.ENSP00000373340	0.636	Peregrin
15	9606.ENSP00000334181	0.634	Lysine-specific demethylase 4D
16	9606.ENSP00000341071	0.633	Rho guanine nucleotide exchange factor 3
17	9606.ENSP00000312379	0.631	Histone-lysine N-methyltransferase 2E
18	9606.ENSP00000432786	0.615	Lysine-specific demethylase 2A
19	9606.ENSP00000376534	0.606	Bromodomain adjacent to zinc finger domain protein 2B
20	9606.ENSP00000371230	0.598	GTP:AMP phosphotransferase AK3, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0032454	1.000	histone H3K9 demethylase activity
GO:0046966	1.000	nuclear thyroid hormone receptor binding
GO:0003676	0.441	nucleic acid binding
GO:0003677	0.370	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.980	biological regulation
GO:0050789	0.956	regulation of biological process
GO:0009987	0.954	cellular process
GO:0050794	0.926	regulation of cellular process
GO:0050896	0.915	response to stimulus
GO:0032501	0.909	multicellular organismal process
GO:0019222	0.898	regulation of metabolic process
GO:0060255	0.892	regulation of macromolecule metabolic process
GO:0010468	0.853	regulation of gene expression
GO:0080090	0.839	regulation of primary metabolic process
GO:0051171	0.839	regulation of nitrogen compound metabolic process
GO:0031323	0.827	regulation of cellular metabolic process
GO:0019219	0.769	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.738	regulation of cellular biosynthetic process
GO:0006355	0.719	regulation of DNA-templated transcription
GO:0050817	0.674	coagulation
GO:0006950	0.629	response to stress
GO:0042060	0.523	wound healing
GO:0007599	0.512	hemostasis
GO:0032502	0.367	developmental process
GO:0048518	0.342	positive regulation of biological process
GO:0048856	0.311	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.697	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]