StarFunc result for job id Q15653

User Input

>input (356 residues)
MAGVACLGKAADADEWCDSGLGSLGPDAAAPGGPGLGAELGPGLSWAPLVFGYVTEDGDT
ALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGL
CVAERRGHTALHLACRVGAHACARALLQPRPRRPREAPDTYLAQGPDRTPDTNHTPVALY
PDSDLEKEEEESEEDWKLQLEAENYEGHTPLHVAVIHKDVEMVRLLRDAGADLDKPEPTC
GRSPLHLAVEAQAADVLELLLRAGANPAARMYGGRTPLGSAMLRPNPILARLLRAHGAPE
PEGEDEKSGPCSSSSDSDSGDEGDEYDDIVVHSSRSQTRLPPTPASKPLPDDPRPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15653	1.000	1.000	1.165E-49	356	1.000	1.000	Q15653.pdb.gz	IKBB_HUMAN NF-kappa-B inhibitor beta OS=Homo sapiens OX=9606 GN=NFKBIB PE=1 SV=2
2	AFDB:Q60778	0.801	0.795	2.280E-40	359	0.848	0.841	Q60778.pdb.gz	IKBB_MOUSE NF-kappa-B inhibitor beta OS=Mus musculus OX=10090 GN=Nfkbib PE=1 SV=2
3	AFDB:A0A024RD24	0.562	0.405	1.013E-14	500	0.292	0.208	A0A024RD24.pdb.gz
4	AFDB:P25963	0.572	0.640	1.219E-14	317	0.281	0.315	P25963.pdb.gz	IKBA_HUMAN NF-kappa-B inhibitor alpha OS=Homo sapiens OX=9606 GN=NFKBIA PE=1 SV=1
5	AFDB:Q6K196	0.555	0.631	2.123E-14	312	0.250	0.285	Q6K196.pdb.gz
6	AFDB:Q20KN0	0.561	0.459	4.877E-14	439	0.289	0.235	Q20KN0.pdb.gz	Q20KN0_CARRO IkB OS=Carcinoscorpius rotundicauda OX=6848 PE=1 SV=1
7	AFDB:Q6P780	0.563	0.550	1.021E-13	365	0.287	0.279	Q6P780.pdb.gz	Q6P780_RAT NFKB inhibitor epsilon OS=Rattus norvegicus OX=10116 GN=Nfkbie PE=4 SV=1
8	AFDB:P20749	0.528	0.418	7.114E-13	454	0.303	0.238	P20749.pdb.gz	BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens OX=9606 GN=BCL3 PE=1 SV=2
9	AFDB:Q0II00	0.545	0.220	7.114E-13	902	0.213	0.084	Q0II00.pdb.gz	Q0II00_DANRE Nuclear factor NF-kappa-B p100 subunit OS=Danio rerio OX=7955 GN=p100 PE=1 SV=1
10	AFDB:Q9Z2F6	0.559	0.446	3.585E-12	448	0.270	0.214	Q9Z2F6.pdb.gz	BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus OX=10090 GN=Bcl3 PE=1 SV=2
11	PDB:8cs9A	0.401	0.204	4.847E-11	796	0.197	0.088	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
12	PDB:2dvwA	0.491	0.746	8.574E-9	229	0.157	0.245	2dvwA.pdb.gz
13	PDB:1wg0A	0.488	0.688	9.928E-8	243	0.135	0.198	1wg0A.pdb.gz
14	PDB:4oauC	0.339	0.201	1.310E-7	692	0.197	0.101	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
15	PDB:6aunA	0.355	0.229	3.792E-7	618	0.160	0.092	6aunA.pdb.gz
16	PDB:5vkqA	0.261	0.065	6.304E-7	1499	0.191	0.045	5vkqA.pdb.gz
17	PDB:6v9hC	0.443	0.575	1.664E-6	270	0.169	0.222	6v9hC.pdb.gz
18	PDB:6mwqA	0.370	0.271	2.096E-6	493	0.140	0.101	6mwqA.pdb.gz
19	PDB:6pqpA	0.438	0.261	3.649E-6	615	0.135	0.078	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
20	PDB:1bd8A	0.371	0.809	6.354E-6	156	0.126	0.288	1bd8A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15653	0.0	711	356	1.000	1.000	IKBB_HUMAN NF-kappa-B inhibitor beta OS=Homo sapiens OX=9606 GN=NFKBIB PE=1 SV=2
2	Q60778	0.0	580	359	0.840	0.833	IKBB_MOUSE NF-kappa-B inhibitor beta OS=Mus musculus OX=10090 GN=Nfkbib PE=1 SV=2
3	Q9JIA3	0.0	564	359	0.809	0.802	IKBB_RAT NF-kappa-B inhibitor beta OS=Rattus norvegicus OX=10116 GN=Nfkbib PE=1 SV=1
4	Q6P780	2.16e-34	131	365	0.239	0.233	Q6P780_RAT NFKB inhibitor epsilon OS=Rattus norvegicus OX=10116 GN=Nfkbie PE=4 SV=1
5	O54910	2.17e-34	131	364	0.242	0.236	IKBE_MOUSE NF-kappa-B inhibitor epsilon OS=Mus musculus OX=10090 GN=Nfkbie PE=1 SV=2
6	A0A8I6ASQ1	2.53e-34	131	358	0.239	0.237	A0A8I6ASQ1_RAT NFKB inhibitor epsilon OS=Rattus norvegicus OX=10116 GN=Nfkbie PE=1 SV=1
7	Q7LC14	1.14e-33	129	361	0.239	0.235	Q7LC14_HUMAN NFKB inhibitor epsilon OS=Homo sapiens OX=9606 GN=NFKBIE PE=1 SV=1
8	F1QCG4	1.33e-33	128	310	0.236	0.271	F1QCG4_DANRE Nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, alpha a OS=Danio rerio OX=7955 GN=fj16a07 PE=4 SV=1
9	O00221	7.40e-33	130	500	0.239	0.170	IKBE_HUMAN NF-kappa-B inhibitor epsilon OS=Homo sapiens OX=9606 GN=NFKBIE PE=1 SV=3
10	Q08353	3.49e-32	124	314	0.272	0.309	IKBA_PIG NF-kappa-B inhibitor alpha OS=Sus scrofa OX=9823 GN=NFKBIA PE=1 SV=1
11	Q9Z1E3	1.36e-31	123	314	0.275	0.312	IKBA_MOUSE NF-kappa-B inhibitor alpha OS=Mus musculus OX=10090 GN=Nfkbia PE=1 SV=2
12	Q63746	1.36e-30	120	314	0.272	0.309	IKBA_RAT NF-kappa-B inhibitor alpha OS=Rattus norvegicus OX=10116 GN=Nfkbia PE=2 SV=1
13	P25963	2.10e-30	120	317	0.264	0.297	IKBA_HUMAN NF-kappa-B inhibitor alpha OS=Homo sapiens OX=9606 GN=NFKBIA PE=1 SV=1
14	H7C0A2	2.48e-29	117	308	0.261	0.302	H7C0A2_HUMAN BCL3 transcription coactivator (Fragment) OS=Homo sapiens OX=9606 GN=BCL3 PE=1 SV=1
15	P20749	5.38e-29	118	454	0.256	0.200	BCL3_HUMAN B-cell lymphoma 3 protein OS=Homo sapiens OX=9606 GN=BCL3 PE=1 SV=2
16	Q20KN0	9.48e-29	117	439	0.272	0.221	Q20KN0_CARRO IkB OS=Carcinoscorpius rotundicauda OX=6848 PE=1 SV=1
17	Q9Z2F6	2.36e-27	114	448	0.247	0.196	BCL3_MOUSE B-cell lymphoma 3 protein homolog OS=Mus musculus OX=10090 GN=Bcl3 PE=1 SV=2
18	Q00653	1.43e-25	110	900	0.270	0.107	NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens OX=9606 GN=NFKB2 PE=1 SV=4
19	Q9WTK5	1.43e-25	110	899	0.272	0.108	NFKB2_MOUSE Nuclear factor NF-kappa-B p100 subunit OS=Mus musculus OX=10090 GN=Nfkb2 PE=1 SV=1
20	E7FFI8	3.78e-25	108	619	0.216	0.124	E7FFI8_DANRE B-cell lymphoma 3 protein homolog OS=Danio rerio OX=7955 GN=bcl3 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	2.8e-18	76.7	Ankyrin repeat
2	PF12796 Ank_2	2.8e-22	90.4	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.5e-21	85.0	Ankyrin repeat
4	PF13637 Ank_4	1.6e-17	74.9	Ankyrin repeats (many copies)
5	PF13857 Ank_5	8.6e-14	62.7	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000312988

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295025	0.999	Proto-oncogene c-Rel
2	9606.ENSP00000384273	0.999	Transcription factor p65
3	9606.ENSP00000359424	0.997	Inhibitor of nuclear factor kappa-B kinase subunit alpha
4	9606.ENSP00000430684	0.995	Inhibitor of nuclear factor kappa-B kinase subunit beta
5	9606.ENSP00000226574	0.991	Nuclear factor NF-kappa-B p105 subunit
6	9606.ENSP00000483825	0.989	NF-kappa-B essential modulator
7	9606.ENSP00000216797	0.983	NF-kappa-B inhibitor alpha
8	9606.ENSP00000393785	0.978	NF-kappa-B inhibitor-interacting Ras-like protein 1
9	9606.ENSP00000303580	0.975	NF-kappa-B inhibitor-interacting Ras-like protein 2
10	9606.ENSP00000358983	0.961	Nuclear factor NF-kappa-B p100 subunit
11	9606.ENSP00000269305	0.938	Cellular tumor antigen p53
12	9606.ENSP00000272317	0.921	Ubiquitin-40S ribosomal protein S27a
13	9606.ENSP00000441543	0.913	Polyubiquitin-C
14	9606.ENSP00000304697	0.912	Polyubiquitin-B
15	9606.ENSP00000388107	0.912	Ubiquitin-60S ribosomal protein L40
16	9606.ENSP00000359206	0.908	F-box/WD repeat-containing protein 1A
17	9606.ENSP00000314080	0.904	Hypermethylated in cancer 1 protein
18	9606.ENSP00000299163	0.863	Hypoxia-inducible factor 1-alpha inhibitor
19	9606.ENSP00000275015	0.861	NF-kappa-B inhibitor epsilon
20	9606.ENSP00000433623	0.839	TNF receptor-associated factor 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140110	0.678	transcription regulator activity
GO:0003713	0.557	transcription coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.997	cellular process
GO:0065007	0.996	biological regulation
GO:0050794	0.993	regulation of cellular process
GO:0071704	0.984	organic substance metabolic process
GO:0051716	0.975	cellular response to stimulus
GO:0023052	0.968	signaling
GO:0044238	0.968	primary metabolic process
GO:0007154	0.968	cell communication
GO:0006807	0.955	nitrogen compound metabolic process
GO:0043170	0.914	macromolecule metabolic process
GO:0044237	0.897	cellular metabolic process
GO:0019222	0.896	regulation of metabolic process
GO:0060255	0.879	regulation of macromolecule metabolic process
GO:0051171	0.874	regulation of nitrogen compound metabolic process
GO:0080090	0.872	regulation of primary metabolic process
GO:0048583	0.870	regulation of response to stimulus
GO:0031323	0.864	regulation of cellular metabolic process
GO:0010468	0.857	regulation of gene expression
GO:0010646	0.823	regulation of cell communication
GO:0023051	0.822	regulation of signaling
GO:0007165	0.798	signal transduction
GO:0048518	0.791	positive regulation of biological process
GO:0019219	0.779	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.775	regulation of macromolecule biosynthetic process
GO:0009966	0.775	regulation of signal transduction
GO:0031326	0.774	regulation of cellular biosynthetic process
GO:0065009	0.771	regulation of molecular function
GO:0051252	0.758	regulation of RNA metabolic process
GO:0048522	0.747	positive regulation of cellular process
GO:0006355	0.725	regulation of DNA-templated transcription
GO:0042221	0.709	response to chemical
GO:0034641	0.625	cellular nitrogen compound metabolic process
GO:0006950	0.606	response to stress
GO:0051090	0.562	regulation of DNA-binding transcription factor activity
GO:0009607	0.535	response to biotic stimulus
GO:0010467	0.533	gene expression
GO:0010033	0.493	response to organic substance
GO:0009605	0.489	response to external stimulus
GO:0044419	0.488	biological process involved in interspecies interaction between organisms
GO:1902531	0.488	regulation of intracellular signal transduction
GO:0009058	0.487	biosynthetic process
GO:0070887	0.484	cellular response to chemical stimulus
GO:1901360	0.471	organic cyclic compound metabolic process
GO:0046483	0.470	heterocycle metabolic process
GO:0006725	0.470	cellular aromatic compound metabolic process
GO:0048519	0.436	negative regulation of biological process
GO:0034654	0.427	nucleobase-containing compound biosynthetic process
GO:0071310	0.418	cellular response to organic substance
GO:0009893	0.409	positive regulation of metabolic process
GO:0009059	0.385	macromolecule biosynthetic process
GO:0006351	0.379	DNA-templated transcription
GO:0043122	0.362	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0048523	0.351	negative regulation of cellular process
GO:0048584	0.341	positive regulation of response to stimulus
GO:0051707	0.328	response to other organism
GO:0010604	0.312	positive regulation of macromolecule metabolic process
GO:0006952	0.302	defense response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.948	intracellular membrane-bounded organelle
GO:0005654	0.939	nucleoplasm
GO:0032991	0.932	protein-containing complex
GO:0016020	0.437	membrane
GO:0012505	0.384	endomembrane system
GO:0005886	0.346	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]