StarFunc result for job id Q15654

User Input

>input (476 residues)
MSGPTWLPPKQPEPARAPQGRAIPRGTPGPPPAHGAALQPHPRVNFCPLPSEQCYQAPGG
PEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDR
QAYEPPPPPAYRTGSLKPNPASPLPASPYGGPTPASYTTASTPAGPAFPVQVKVAQPVRG
CGPPRRGASQASGPLPGPHFPLPGRGEVWGPGYRSQREPGPGAKEEAAGVSGPAGRGRGG
EHGPQVPLSQPPEDELDRLTKKLVHDMNHPPSGEYFGQCGGCGEDVVGDGAGVVALDRVF
HVGCFVCSTCRAQLRGQHFYAVERRAYCEGCYVATLEKCATCSQPILDRILRAMGKAYHP
GCFTCVVCHRGLDGIPFTVDATSQIHCIEDFHRKFAPRCSVCGGAIMPEPGQEETVRIVA
LDRSFHIGCYKCEECGLLLSSEGECQGCYPLDGHILCKACSAWRIQELSATVTTDC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15654	1.000	1.000	2.607E-83	476	1.000	1.000	Q15654.pdb.gz	TRIP6_HUMAN Thyroid receptor-interacting protein 6 OS=Homo sapiens OX=9606 GN=TRIP6 PE=1 SV=3
2	AFDB:Q9Z1Y4	0.560	0.556	2.385E-72	480	0.872	0.865	Q9Z1Y4.pdb.gz	TRIP6_MOUSE Thyroid receptor-interacting protein 6 OS=Mus musculus OX=10090 GN=Trip6 PE=1 SV=1
3	AFDB:Q9N675	0.406	0.334	3.722E-31	585	0.321	0.262	Q9N675.pdb.gz	Q9N675_DROME Zyx102 protein OS=Drosophila melanogaster OX=7227 GN=Zyx PE=1 SV=1
4	AFDB:Q4ZGL5	0.317	0.259	1.063E-14	596	0.231	0.185	Q4ZGL5.pdb.gz
5	AFDB:A0A1D8PRQ6	0.201	0.082	1.665E-10	1468	0.166	0.054	A0A1D8PRQ6.pdb.gz	A0A1D8PRQ6_CANAL Lrg1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=LRG1 PE=4 SV=1
6	AFDB:Q54Z52	0.144	0.088	7.909E-10	822	0.101	0.058	Q54Z52.pdb.gz	Q54Z52_DICDI Prespore-specific protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277777 PE=4 SV=1
7	PDB:4kfzB	0.129	0.363	1.615E-8	148	0.080	0.257	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
8	PDB:1b8tA	0.120	0.277	4.688E-6	192	0.090	0.224	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
9	AFDB:Q14202	0.106	0.047	1.404E-5	1370	0.218	0.076	Q14202.pdb.gz	ZMYM3_HUMAN Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=2
10	PDB:1imlA	0.107	0.564	3.690E-3	76	0.038	0.237	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
11	AFDB:Q8TC41	0.089	0.081	5.945E-2	542	0.164	0.144	Q8TC41.pdb.gz	RN217_HUMAN E3 ubiquitin-protein ligase RNF217 OS=Homo sapiens OX=9606 GN=RNF217 PE=1 SV=4
12	AFDB:Q6AW69	0.080	0.043	1.514E-1	1298	0.111	0.041	Q6AW69.pdb.gz	CGNL1_MOUSE Cingulin-like protein 1 OS=Mus musculus OX=10090 GN=Cgnl1 PE=1 SV=3
13	AFDB:Q9R1D1	0.070	0.051	3.855E-1	737	0.120	0.077	Q9R1D1.pdb.gz	CTCF_RAT Transcriptional repressor CTCF OS=Rattus norvegicus OX=10116 GN=Ctcf PE=2 SV=1
14	PDB:7uhyC	0.049	0.044	8.350E-1	578	0.038	0.031	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
15	PDB:7uhyD	0.074	0.114	1.007	288	0.034	0.056	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
16	PDB:4kblA	0.084	0.098	1.877	395	0.053	0.063	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
17	PDB:2m1sA	0.063	0.252	2.263	99	0.021	0.101	2m1sA.pdb.gz	Structural characterization of the Z RING-eIF4E complex reveals a distinct mode of control for eIF4E
18	PDB:8a3tU	0.076	0.281	2.263	114	0.019	0.079	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
19	PDB:4r8pL	0.071	0.113	2.409	254	0.023	0.043	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
20	PDB:5gm6a	0.062	0.193	2.409	123	0.025	0.098	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15654	0.0	952	476	1.000	1.000	TRIP6_HUMAN Thyroid receptor-interacting protein 6 OS=Homo sapiens OX=9606 GN=TRIP6 PE=1 SV=3
2	Q9Z1Y4	0.0	811	480	0.872	0.865	TRIP6_MOUSE Thyroid receptor-interacting protein 6 OS=Mus musculus OX=10090 GN=Trip6 PE=1 SV=1
3	Q7ZU85	2.48e-127	383	556	0.466	0.399	Q7ZU85_DANRE LIM domain containing preferred translocation partner in lipoma OS=Danio rerio OX=7955 GN=zgc:56152 PE=1 SV=1
4	Q93052	5.49e-125	379	612	0.548	0.426	LPP_HUMAN Lipoma-preferred partner OS=Homo sapiens OX=9606 GN=LPP PE=1 SV=1
5	A0A087WZF1	3.02e-123	373	590	0.494	0.398	A0A087WZF1_HUMAN LIM domain containing preferred translocation partner in lipoma OS=Homo sapiens OX=9606 GN=LPP PE=1 SV=1
6	Q8BFW7	1.07e-112	347	613	0.328	0.254	LPP_MOUSE Lipoma-preferred partner homolog OS=Mus musculus OX=10090 GN=Lpp PE=1 SV=1
7	H9XVP5	8.10e-89	281	496	0.252	0.242	H9XVP5_DROME Zyxin, isoform H OS=Drosophila melanogaster OX=7227 GN=Zyx PE=4 SV=1
8	Q8I0G8	1.63e-88	281	523	0.252	0.229	Q8I0G8_DROME FI16750p1 OS=Drosophila melanogaster OX=7227 GN=Zyx PE=2 SV=1
9	Q8T0F5	2.52e-88	282	564	0.252	0.213	Q8T0F5_DROME LD06023 isoform OS=Drosophila melanogaster OX=7227 GN=Zyx PE=2 SV=1
10	Q9N675	3.02e-88	283	585	0.252	0.205	Q9N675_DROME Zyx102 protein OS=Drosophila melanogaster OX=7227 GN=Zyx PE=1 SV=1
11	Q5U0W6	3.83e-85	273	525	0.244	0.221	Q5U0W6_DROME HL05789p OS=Drosophila melanogaster OX=7227 GN=Zyx PE=2 SV=1
12	Q04584	3.47e-83	268	542	0.275	0.242	ZYX_CHICK Zyxin OS=Gallus gallus OX=9031 GN=ZYX PE=1 SV=1
13	Q62523	1.93e-79	259	564	0.361	0.305	ZYX_MOUSE Zyxin OS=Mus musculus OX=10090 GN=Zyx PE=1 SV=2
14	A0A8I6AV84	2.92e-77	253	533	0.267	0.238	A0A8I6AV84_RAT Zyxin OS=Rattus norvegicus OX=10116 GN=Zyx PE=1 SV=1
15	A0A8I6GKY5	2.09e-76	254	666	0.357	0.255	A0A8I6GKY5_RAT Zyxin OS=Rattus norvegicus OX=10116 GN=Zyx PE=4 SV=1
16	D4A7U1	2.20e-76	254	667	0.357	0.255	D4A7U1_RAT Zyxin OS=Rattus norvegicus OX=10116 GN=Zyx PE=1 SV=2
17	H0Y2Y8	3.21e-76	250	540	0.269	0.237	H0Y2Y8_HUMAN Zyxin (Fragment) OS=Homo sapiens OX=9606 GN=ZYX PE=1 SV=1
18	Q15942	6.63e-76	250	572	0.269	0.224	ZYX_HUMAN Zyxin OS=Homo sapiens OX=9606 GN=ZYX PE=1 SV=1
19	Q9U3F4	3.04e-71	239	603	0.204	0.161	ZYX_CAEEL Zyxin OS=Caenorhabditis elegans OX=6239 GN=zyx-1 PE=1 SV=1
20	A5H447	3.69e-70	237	663	0.239	0.172	ZYX_XENLA Zyxin OS=Xenopus laevis OX=8355 GN=zyx PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00412 LIM	2.3e-28	109.5	LIM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000200457

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000443256	0.999	Lysophosphatidic acid receptor 2
2	9606.ENSP00000300574	0.991	Adapter molecule crk
3	9606.ENSP00000391669	0.987	Breast cancer anti-estrogen resistance protein 1
4	9606.ENSP00000408005	0.986	Na(+)/H(+) exchange regulatory cofactor NHE-RF2
5	9606.ENSP00000362680	0.962	Proto-oncogene tyrosine-protein kinase Src
6	9606.ENSP00000267257	0.960	Paxillin
7	9606.ENSP00000341189	0.952	Focal adhesion kinase 1
8	9606.ENSP00000306245	0.949	Proto-oncogene c-Fos
9	9606.ENSP00000231509	0.929	Glucocorticoid receptor
10	9606.ENSP00000368759	0.928	Enhancer of filamentation 1
11	9606.ENSP00000360266	0.915	Transcription factor AP-1
12	9606.ENSP00000362299	0.895	Endoglin
13	9606.ENSP00000253754	0.856	PDZ and LIM domain protein 4
14	9606.ENSP00000211998	0.849	Vinculin
15	9606.ENSP00000220514	0.848	Protein Mis18-beta
16	9606.ENSP00000355133	0.843	Carboxyl-terminal PDZ ligand of neuronal nitric oxide synthase protein
17	9606.ENSP00000220751	0.840	Receptor-interacting serine/threonine-protein kinase 2
18	9606.ENSP00000394794	0.779	Tyrosine-protein phosphatase non-receptor type 13
19	9606.ENSP00000374354	0.766	Exosome complex component RRP43
20	9606.ENSP00000445675	0.766	Melanoma antigen preferentially expressed in tumors

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.863	heterocyclic compound binding
GO:0097159	0.863	organic cyclic compound binding
GO:0003676	0.761	nucleic acid binding
GO:0019899	0.352	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.988	regulation of biological process
GO:0050794	0.961	regulation of cellular process
GO:0048518	0.792	positive regulation of biological process
GO:0009987	0.787	cellular process
GO:0048583	0.785	regulation of response to stimulus
GO:0009966	0.765	regulation of signal transduction
GO:1902531	0.745	regulation of intracellular signal transduction
GO:0048522	0.685	positive regulation of cellular process
GO:0040012	0.601	regulation of locomotion
GO:0050896	0.513	response to stimulus
GO:1901222	0.479	regulation of NIK/NF-kappaB signaling
GO:0032501	0.441	multicellular organismal process
GO:0032502	0.403	developmental process
GO:0048856	0.382	anatomical structure development
GO:0019222	0.343	regulation of metabolic process
GO:0048584	0.336	positive regulation of response to stimulus
GO:0009967	0.326	positive regulation of signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:0030055	0.999	cell-substrate junction
GO:0005829	0.997	cytosol
GO:0005886	0.995	plasma membrane
GO:0005925	0.993	focal adhesion
GO:0005634	0.991	nucleus
GO:0043232	0.986	intracellular non-membrane-bounded organelle
GO:0005856	0.865	cytoskeleton
GO:0070013	0.624	intracellular organelle lumen
GO:0031981	0.390	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]