StarFunc result for job id Q15669

User Input

>input (191 residues)
MLSSIKCVLVGDSAVGKTSLLVRFTSETFPEAYKPTVYENTGVDVFMDGIQISLGLWDTA
GNDAFRSIRPLSYQQADVVLMCYSVANHNSFLNLKNKWIGEIRSNLPCTPVLVVATQTDQ
REMGPHRASCVNAMEGKKLAQDVRAKGYLECSALSNRGVQQVFECAVRTAVNQARRRNRR
RLFSINECKIF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15669	1.000	1.000	9.540E-41	191	1.000	1.000	Q15669.pdb.gz	RHOH_HUMAN Rho-related GTP-binding protein RhoH OS=Homo sapiens OX=9606 GN=RHOH PE=1 SV=1
2	AFDB:P0CY33	0.858	0.858	4.995E-24	191	0.408	0.408	P0CY33.pdb.gz	CDC42_CANAL Cell division control protein 42 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC42 PE=3 SV=1
3	AFDB:P40792	0.848	0.844	8.873E-24	192	0.387	0.385	P40792.pdb.gz	RAC1_DROME Ras-related protein Rac1 OS=Drosophila melanogaster OX=7227 GN=Rac1 PE=1 SV=2
4	AFDB:A2BHI1	0.848	0.741	1.145E-23	219	0.387	0.338	A2BHI1.pdb.gz
5	AFDB:P40793	0.849	0.849	1.387E-23	191	0.398	0.398	P40793.pdb.gz	CDC42_DROME Cdc42 homolog OS=Drosophila melanogaster OX=7227 GN=Cdc42 PE=1 SV=1
6	AFDB:B2RYP0	0.887	0.878	1.680E-23	193	0.414	0.409	B2RYP0.pdb.gz	B2RYP0_RAT Ras homolog family member C OS=Rattus norvegicus OX=10116 GN=Rhoc PE=1 SV=1
7	AFDB:G5EBV3	0.863	0.846	2.035E-23	195	0.429	0.421	G5EBV3.pdb.gz	G5EBV3_CAEEL Rac-like GTPase OS=Caenorhabditis elegans OX=6239 GN=mig-2 PE=1 SV=1
8	AFDB:Q7JWS8	0.852	0.834	2.312E-23	195	0.424	0.415	Q7JWS8.pdb.gz	Q7JWS8_DROME AT17867p OS=Drosophila melanogaster OX=7227 GN=Mtl PE=1 SV=1
9	AFDB:P34148	0.856	0.839	2.984E-23	195	0.377	0.369	P34148.pdb.gz	RACB_DICDI Rho-related protein racB OS=Dictyostelium discoideum OX=44689 GN=racB PE=1 SV=1
10	AFDB:Q94124	0.854	0.837	2.984E-23	195	0.387	0.379	Q94124.pdb.gz	RAC2_CAEEL Ras-related protein rac-2 OS=Caenorhabditis elegans OX=6239 GN=rac-2 PE=3 SV=1
11	PDB:5c2kA	0.864	0.437	9.833E-23	382	0.382	0.191	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
12	PDB:6hxuA	0.856	0.898	1.048E-22	182	0.382	0.401	6hxuA.pdb.gz	A Targeted Protein Degradation Cell-Based Screening for Nanobodies Selective toward the Cellular RHOB GTP-Bound Conformation.
13	PDB:2wkpA	0.841	0.506	5.171E-22	320	0.382	0.228	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
14	PDB:4mitC	0.847	0.893	1.531E-21	181	0.356	0.376	4mitC.pdb.gz	Entamoeba histolytica RacC Selectively Engages p21-Activated Kinase Effectors.
15	PDB:1nf3A	0.832	0.819	1.854E-21	194	0.403	0.397	1nf3A.pdb.gz	Structure of Cdc42 in a complex with the GTPase-binding domain of the cell polarity protein, Par6
16	PDB:3a58F	0.841	0.886	1.854E-21	181	0.361	0.381	3a58F.pdb.gz	Structural basis for the Rho- and phosphoinositide-dependent localization of the exocyst subunit Sec3
17	PDB:6jikA	0.851	0.892	2.393E-21	182	0.372	0.390	6jikA.pdb.gz	Aspergillus fumigatus Rho1 gSGTP complex
18	PDB:6ukaA	0.845	0.910	1.342E-20	177	0.377	0.407	6ukaA.pdb.gz	Structure of the DOCK2-ELMO1 complex provides insights into regulation of the auto-inhibited state.
19	PDB:2atxA	0.846	0.868	7.025E-19	186	0.377	0.387	2atxA.pdb.gz	An electrostatic steering mechanism of Cdc42 recognition by Wiskott-Aldrich syndrome proteins
20	PDB:2j0vB	0.819	0.849	1.611E-18	184	0.346	0.359	2j0vB.pdb.gz	The Crystal Structure of Arabidopsis Thaliana Rac7/Rop9: The First Ras Superfamily Gtpase from the Plant Kingdom.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15669	6.55e-144	399	191	1.000	1.000	RHOH_HUMAN Rho-related GTP-binding protein RhoH OS=Homo sapiens OX=9606 GN=RHOH PE=1 SV=1
2	Q9D3G9	2.41e-140	390	191	0.969	0.969	RHOH_MOUSE Rho-related GTP-binding protein RhoH OS=Mus musculus OX=10090 GN=Rhoh PE=1 SV=1
3	G5EBV3	6.63e-54	172	195	0.429	0.421	G5EBV3_CAEEL Rac-like GTPase OS=Caenorhabditis elegans OX=6239 GN=mig-2 PE=1 SV=1
4	Q7JWS8	9.61e-54	171	195	0.429	0.421	Q7JWS8_DROME AT17867p OS=Drosophila melanogaster OX=7227 GN=Mtl PE=1 SV=1
5	Q03206	6.51e-53	169	191	0.414	0.414	RAC1_CAEEL Ras-related protein ced-10 OS=Caenorhabditis elegans OX=6239 GN=ced-10 PE=1 SV=2
6	Q6PFU4	5.82e-52	167	191	0.408	0.408	Q6PFU4_DANRE Cell division control protein 42 homolog OS=Danio rerio OX=7955 GN=cdc42a PE=1 SV=1
7	P60766	6.63e-52	166	191	0.414	0.414	CDC42_MOUSE Cell division control protein 42 homolog OS=Mus musculus OX=10090 GN=Cdc42 PE=1 SV=2
8	P60953	6.63e-52	166	191	0.414	0.414	CDC42_HUMAN Cell division control protein 42 homolog OS=Homo sapiens OX=9606 GN=CDC42 PE=1 SV=2
9	Q8CFN2	6.63e-52	166	191	0.414	0.414	CDC42_RAT Cell division control protein 42 homolog OS=Rattus norvegicus OX=10116 GN=Cdc42 PE=1 SV=2
10	Q52WY2	7.00e-52	166	191	0.414	0.414	Q52WY2_DANRE Cell division control protein 42 homolog OS=Danio rerio OX=7955 GN=cdc42a PE=1 SV=1
11	P62998	2.97e-51	165	192	0.398	0.396	RAC1_BOVIN Ras-related C3 botulinum toxin substrate 1 OS=Bos taurus OX=9913 GN=RAC1 PE=1 SV=1
12	P63000	2.97e-51	165	192	0.398	0.396	RAC1_HUMAN Ras-related C3 botulinum toxin substrate 1 OS=Homo sapiens OX=9606 GN=RAC1 PE=1 SV=1
13	P63001	2.97e-51	165	192	0.398	0.396	RAC1_MOUSE Ras-related C3 botulinum toxin substrate 1 OS=Mus musculus OX=10090 GN=Rac1 PE=1 SV=1
14	Q6LC82	2.97e-51	165	192	0.398	0.396	Q6LC82_CHICK GTPase cRac1A OS=Gallus gallus OX=9031 GN=cRac1A PE=2 SV=1
15	Q6RUV5	2.97e-51	165	192	0.398	0.396	RAC1_RAT Ras-related C3 botulinum toxin substrate 1 OS=Rattus norvegicus OX=10116 GN=Rac1 PE=1 SV=1
16	Q05144	6.30e-51	164	192	0.398	0.396	RAC2_MOUSE Ras-related C3 botulinum toxin substrate 2 OS=Mus musculus OX=10090 GN=Rac2 PE=1 SV=1
17	Q5U1Y2	6.30e-51	164	192	0.398	0.396	Q5U1Y2_RAT Ras-related C3 botulinum toxin substrate 2 (Rho family, small GTP binding protein Rac2) OS=Rattus norvegicus OX=10116 GN=Rac2 PE=2 SV=1
18	P40793	1.81e-50	163	191	0.403	0.403	CDC42_DROME Cdc42 homolog OS=Drosophila melanogaster OX=7227 GN=Cdc42 PE=1 SV=1
19	P48554	1.91e-50	163	192	0.393	0.391	RAC2_DROME Ras-related protein Rac2 OS=Drosophila melanogaster OX=7227 GN=Rac2 PE=1 SV=1
20	B2RYP0	2.01e-50	163	193	0.408	0.404	B2RYP0_RAT Ras homolog family member C OS=Rattus norvegicus OX=10116 GN=Rhoc PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	4.7e+02	12.5	AAA ATPase domain
2	PF00025 Arf	0.00016	32.7	ADP-ribosylation factor family
3	PF01926 MMR_HSR1	13	17.3	50S ribosome-binding GTPase
4	PF10662 PduV-EutP	3.2e+02	12.5	Ethanolamine utilisation - propanediol utilisation
5	PF00071 Ras	1.1e-41	153.6	Ras family
6	PF08477 Roc	9.5e-19	79.2	Ras of Complex, Roc, domain of DAPkinase
7	PF03193 RsgA_GTPase	5.1e+02	11.9	RsgA GTPase
8	PF09439 SRPRB	1.4e+02	13.3	Signal recognition particle receptor beta subunit
9	PF05621 TniB	3.1e+02	12.2	Bacterial TniB protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371219

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264972	0.962	Tyrosine-protein kinase ZAP-70
2	9606.ENSP00000269321	0.943	Rho GDP-dissociation inhibitor 1
3	9606.ENSP00000228945	0.898	Rho GDP-dissociation inhibitor 2
4	9606.ENSP00000043402	0.855	Reticulon-4 receptor
5	9606.ENSP00000219409	0.824	Rho GDP-dissociation inhibitor 3
6	9606.ENSP00000272233	0.816	Rho-related GTP-binding protein RhoB
7	9606.ENSP00000337825	0.799	Tyrosine-protein kinase Lck
8	9606.ENSP00000451828	0.798	RAC-alpha serine/threonine-protein kinase
9	9606.ENSP00000472929	0.684	Proto-oncogene vav
10	9606.ENSP00000350844	0.681	Paired box protein Pax-5
11	9606.ENSP00000365891	0.666	Wiskott-Aldrich syndrome protein
12	9606.ENSP00000430276	0.653	Proto-oncogene DBL
13	9606.ENSP00000384371	0.647	B-cell lymphoma 6 protein
14	9606.ENSP00000479134	0.634	Formin-1
15	9606.ENSP00000314153	0.607	Transcriptional regulator Kaiso
16	9606.ENSP00000382004	0.589	Catenin delta-1
17	9606.ENSP00000286827	0.580	T-lymphoma invasion and metastasis-inducing protein 1
18	9606.ENSP00000220062	0.579	Ras-like protein family member 12
19	9606.ENSP00000229335	0.573	Single-stranded DNA cytosine deaminase
20	9606.ENSP00000249071	0.572	Ras-related C3 botulinum toxin substrate 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003824	0.920	catalytic activity
GO:0003924	0.894	GTPase activity
GO:0035639	0.877	purine ribonucleoside triphosphate binding
GO:0005525	0.870	GTP binding
GO:0098772	0.387	molecular function regulator activity
GO:0030234	0.339	enzyme regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050794	0.982	regulation of cellular process
GO:0048518	0.961	positive regulation of biological process
GO:0048583	0.952	regulation of response to stimulus
GO:0048522	0.948	positive regulation of cellular process
GO:0032502	0.913	developmental process
GO:0009966	0.913	regulation of signal transduction
GO:1903037	0.905	regulation of leukocyte cell-cell adhesion
GO:0050863	0.895	regulation of T cell activation
GO:0032501	0.891	multicellular organismal process
GO:0048856	0.882	anatomical structure development
GO:0051251	0.877	positive regulation of lymphocyte activation
GO:0045785	0.873	positive regulation of cell adhesion
GO:1903039	0.854	positive regulation of leukocyte cell-cell adhesion
GO:0001775	0.853	cell activation
GO:0045619	0.839	regulation of lymphocyte differentiation
GO:0002376	0.835	immune system process
GO:0050870	0.829	positive regulation of T cell activation
GO:0048519	0.813	negative regulation of biological process
GO:0045580	0.813	regulation of T cell differentiation
GO:1903708	0.802	positive regulation of hemopoiesis
GO:0048523	0.801	negative regulation of cellular process
GO:1902531	0.800	regulation of intracellular signal transduction
GO:0045621	0.792	positive regulation of lymphocyte differentiation
GO:0045321	0.761	leukocyte activation
GO:0046649	0.744	lymphocyte activation
GO:0045582	0.709	positive regulation of T cell differentiation
GO:0030154	0.708	cell differentiation
GO:0043122	0.704	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0050896	0.668	response to stimulus
GO:0048468	0.602	cell development
GO:0042110	0.541	T cell activation
GO:0002521	0.539	leukocyte differentiation
GO:0002274	0.537	myeloid leukocyte activation
GO:1903131	0.521	mononuclear cell differentiation
GO:0045576	0.476	mast cell activation
GO:0043124	0.464	negative regulation of I-kappaB kinase/NF-kappaB signaling
GO:0051716	0.393	cellular response to stimulus
GO:0023052	0.385	signaling
GO:0007165	0.381	signal transduction
GO:0071840	0.348	cellular component organization or biogenesis
GO:0016043	0.334	cellular component organization
GO:0030098	0.318	lymphocyte differentiation
GO:0019222	0.312	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0043226	0.911	organelle
GO:0043229	0.887	intracellular organelle
GO:0043227	0.753	membrane-bounded organelle
GO:0043231	0.669	intracellular membrane-bounded organelle
GO:0012505	0.439	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.894	GTP + H2O = GDP + H(+) + phosphate

[back to server]