StarFunc result for job id Q15672

User Input

>input (202 residues)
MMQDVSSSPVSPADDSLSNSEEEPDRQQPPSGKRGGRKRRSSRRSAGGGAGPGGAAGGGV
GGGDEPGSPAQGKRGKKSAGCGGGGGAGGGGGSSSGGGSPQSYEELQTQRVMANVRERQR
TQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDELDSKMASCSYVAH
ERLSYAFSVWRMEGAWSMSASH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P26687	0.596	0.586	4.611E-23	206	0.970	0.951	P26687.pdb.gz	TWST1_MOUSE Twist-related protein 1 OS=Mus musculus OX=10090 GN=Twist1 PE=1 SV=1
2	AFDB:Q9PTE3	0.530	0.624	2.957E-16	171	0.658	0.778	Q9PTE3.pdb.gz	Q9PTE3_DANRE Transcription factor twist1 OS=Danio rerio OX=7955 GN=Twist1b PE=2 SV=1
3	AFDB:A1MB48	0.519	0.650	1.222E-15	160	0.658	0.831	A1MB48.pdb.gz
4	AFDB:P13903	0.450	0.538	1.505E-13	166	0.693	0.843	P13903.pdb.gz	TWIST_XENLA Twist-related protein OS=Xenopus laevis OX=8355 GN=twist1 PE=2 SV=1
5	AFDB:Q568M7	0.446	0.525	2.179E-13	169	0.698	0.834	Q568M7.pdb.gz	Q568M7_DANRE Twist family bHLH transcription factor 1b OS=Danio rerio OX=7955 GN=twist1a PE=2 SV=1
6	AFDB:P10627	0.400	0.171	4.692E-8	490	0.431	0.178	P10627.pdb.gz	TWIST_DROME Protein twist OS=Drosophila melanogaster OX=7227 GN=twi PE=1 SV=2
7	AFDB:Q7RTS1	0.302	0.321	6.410E-5	189	0.228	0.243	Q7RTS1.pdb.gz	BHA15_HUMAN Class A basic helix-loop-helix protein 15 OS=Homo sapiens OX=9606 GN=BHLHA15 PE=1 SV=1
8	AFDB:O60682	0.305	0.300	1.117E-4	206	0.292	0.286	O60682.pdb.gz	MUSC_HUMAN Musculin OS=Homo sapiens OX=9606 GN=MSC PE=1 SV=2
9	AFDB:B6VQA1	0.340	0.178	4.618E-4	390	0.277	0.144	B6VQA1.pdb.gz	DIMM_DROME Protein dimmed OS=Drosophila melanogaster OX=7227 GN=dimm PE=1 SV=1
10	AFDB:O88940	0.310	0.312	4.911E-4	201	0.277	0.279	O88940.pdb.gz	MUSC_MOUSE Musculin OS=Mus musculus OX=10090 GN=Msc PE=1 SV=1
11	PDB:3b0dC	0.210	0.480	1.723	75	0.069	0.187	3b0dC.pdb.gz
12	PDB:3rx6A	0.151	0.161	2.346	187	0.104	0.112	3rx6A.pdb.gz
13	PDB:6lo8H	0.172	0.390	3.613	74	0.054	0.149	6lo8H.pdb.gz
14	PDB:5imjA	0.112	0.098	4.088	246	0.035	0.028	5imjA.pdb.gz
15	PDB:1qsdA	0.140	0.256	4.348	102	0.064	0.127	1qsdA.pdb.gz
16	PDB:7lbmY	0.190	0.178	4.348	218	0.059	0.055	7lbmY.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
17	PDB:4jdqF	0.177	0.380	4.625	90	0.079	0.178	4jdqF.pdb.gz
18	PDB:6rj9A	0.162	0.176	4.625	183	0.020	0.022	6rj9A.pdb.gz	Cas9 Allosteric Inhibition by the Anti-CRISPR Protein AcrIIA6.
19	PDB:7edxl	0.168	0.291	4.625	107	0.054	0.103	7edxl.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
20	PDB:6wjv4	0.186	0.300	4.919	107	0.050	0.093	6wjv4.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15672	1.29e-144	402	202	1.000	1.000	TWST1_HUMAN Twist-related protein 1 OS=Homo sapiens OX=9606 GN=TWIST1 PE=1 SV=1
2	Q9EPJ1	1.05e-136	382	203	0.965	0.961	Q9EPJ1_RAT Twist-related protein 1 OS=Rattus norvegicus OX=10116 GN=Twist1 PE=1 SV=1
3	Q9PVG4	3.40e-99	287	190	0.832	0.884	Q9PVG4_CHICK CTwist OS=Gallus gallus OX=9031 GN=TWIST1 PE=2 SV=1
4	P26687	7.25e-99	286	206	0.946	0.927	TWST1_MOUSE Twist-related protein 1 OS=Mus musculus OX=10090 GN=Twist1 PE=1 SV=1
5	P13903	2.07e-82	243	166	0.634	0.771	TWIST_XENLA Twist-related protein OS=Xenopus laevis OX=8355 GN=twist1 PE=2 SV=1
6	Q568M7	2.31e-82	243	169	0.688	0.822	Q568M7_DANRE Twist family bHLH transcription factor 1b OS=Danio rerio OX=7955 GN=twist1a PE=2 SV=1
7	P97831	3.08e-76	228	160	0.609	0.769	TWST2_RAT Twist-related protein 2 OS=Rattus norvegicus OX=10116 GN=Twist2 PE=2 SV=2
8	Q8WVJ9	3.08e-76	228	160	0.609	0.769	TWST2_HUMAN Twist-related protein 2 OS=Homo sapiens OX=9606 GN=TWIST2 PE=1 SV=1
9	Q9D030	1.52e-75	226	160	0.604	0.762	TWST2_MOUSE Twist-related protein 2 OS=Mus musculus OX=10090 GN=Twist2 PE=1 SV=1
10	Q9PTE3	1.95e-75	226	171	0.639	0.754	Q9PTE3_DANRE Transcription factor twist1 OS=Danio rerio OX=7955 GN=Twist1b PE=2 SV=1
11	P10627	5.23e-28	111	490	0.356	0.147	TWIST_DROME Protein twist OS=Drosophila melanogaster OX=7227 GN=twi PE=1 SV=2
12	Q11094	1.41e-17	78.6	178	0.213	0.242	TWIST_CAEEL Twist-related protein OS=Caenorhabditis elegans OX=6239 GN=hlh-8 PE=1 SV=2
13	Q62282	4.36e-16	72.8	108	0.173	0.324	TAL2_MOUSE T-cell acute lymphocytic leukemia protein 2 homolog OS=Mus musculus OX=10090 GN=Tal2 PE=4 SV=1
14	Q9VL05	5.70e-16	74.3	174	0.203	0.236	Q9VL05_DROME FI14601p OS=Drosophila melanogaster OX=7227 GN=Hand PE=2 SV=3
15	Q16559	1.94e-15	71.2	108	0.168	0.315	TAL2_HUMAN T-cell acute lymphocytic leukemia protein 2 OS=Homo sapiens OX=9606 GN=TAL2 PE=1 SV=1
16	Q9QX98	2.81e-15	74.7	324	0.233	0.145	PTF1A_MOUSE Pancreas transcription factor 1 subunit alpha OS=Mus musculus OX=10090 GN=Ptf1a PE=1 SV=1
17	Q7RTS3	5.79e-15	73.9	328	0.183	0.113	PTF1A_HUMAN Pancreas transcription factor 1 subunit alpha OS=Homo sapiens OX=9606 GN=PTF1A PE=1 SV=1
18	Q64305	7.31e-15	73.6	326	0.183	0.113	PTF1A_RAT Pancreas transcription factor 1 subunit alpha OS=Rattus norvegicus OX=10116 GN=Ptf1a PE=1 SV=1
19	P57102	9.70e-15	71.6	208	0.168	0.163	HAND2_DANRE Heart- and neural crest derivatives-expressed protein 2 OS=Danio rerio OX=7955 GN=hand2 PE=2 SV=1
20	Q7ZSX3	9.96e-15	72.8	265	0.183	0.140	PTF1A_DANRE Pancreas transcription factor 1 subunit alpha OS=Danio rerio OX=7955 GN=ptf1a PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05600 CDK5RAP3	72	13.5	CDK5 regulatory subunit-associated protein 3
2	PF12466 GDH_N	4.2e+02	12.5	Glutamate dehydrogenase N terminal
3	PF00010 HLH	5e-12	56.9	Helix-loop-helix DNA-binding domain
4	PF18558 HTH_51	8.6	17.7	Helix-turn-helix domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000242261

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360493	0.992	Runt-related transcription factor 2
2	9606.ENSP00000262965	0.991	Transcription factor E2-alpha
3	9606.ENSP00000354487	0.986	Zinc finger E-box-binding homeobox 1
4	9606.ENSP00000352738	0.985	Ras GTPase-activating protein-binding protein 2
5	9606.ENSP00000437955	0.979	Hypoxia-inducible factor 1-alpha
6	9606.ENSP00000264657	0.974	Signal transducer and activator of transcription 3
7	9606.ENSP00000269305	0.971	Cellular tumor antigen p53
8	9606.ENSP00000323588	0.969	Transcription factor SOX-2
9	9606.ENSP00000388940	0.965	Transcription factor 12
10	9606.ENSP00000264867	0.964	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
11	9606.ENSP00000479618	0.962	Myc proto-oncogene protein
12	9606.ENSP00000418915	0.956	Cyclin-dependent kinase inhibitor 2A
13	9606.ENSP00000229307	0.954	Homeobox protein NANOG
14	9606.ENSP00000227507	0.951	G1/S-specific cyclin-D1
15	9606.ENSP00000306245	0.944	Proto-oncogene c-Fos
16	9606.ENSP00000398632	0.939	CD44 antigen
17	9606.ENSP00000244050	0.932	Zinc finger protein SNAI1
18	9606.ENSP00000384371	0.927	B-cell lymphoma 6 protein
19	9606.ENSP00000385824	0.925	Forkhead box protein O3
20	9606.ENSP00000368880	0.923	Forkhead box protein O1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0042803	1.000	protein homodimerization activity
GO:0043425	0.997	bHLH transcription factor binding
GO:0070888	0.997	E-box binding
GO:0001228	0.905	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0001221	0.613	transcription coregulator binding
GO:0019904	0.582	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0048522	0.993	positive regulation of cellular process
GO:0032501	0.987	multicellular organismal process
GO:0048856	0.987	anatomical structure development
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0009987	0.984	cellular process
GO:0050793	0.966	regulation of developmental process
GO:0048523	0.957	negative regulation of cellular process
GO:0010468	0.947	regulation of gene expression
GO:0009653	0.927	anatomical structure morphogenesis
GO:0007275	0.917	multicellular organism development
GO:0031323	0.916	regulation of cellular metabolic process
GO:0050896	0.913	response to stimulus
GO:0048513	0.912	animal organ development
GO:0048731	0.903	system development
GO:0009893	0.897	positive regulation of metabolic process
GO:0080090	0.871	regulation of primary metabolic process
GO:0051171	0.871	regulation of nitrogen compound metabolic process
GO:0010604	0.864	positive regulation of macromolecule metabolic process
GO:0010556	0.850	regulation of macromolecule biosynthetic process
GO:0031326	0.847	regulation of cellular biosynthetic process
GO:0019219	0.842	regulation of nucleobase-containing compound metabolic process
GO:0009892	0.818	negative regulation of metabolic process
GO:0051173	0.790	positive regulation of nitrogen compound metabolic process
GO:0051239	0.767	regulation of multicellular organismal process
GO:0051716	0.765	cellular response to stimulus
GO:2001141	0.761	regulation of RNA biosynthetic process
GO:0031325	0.755	positive regulation of cellular metabolic process
GO:0072359	0.744	circulatory system development
GO:0006355	0.738	regulation of DNA-templated transcription
GO:0051094	0.693	positive regulation of developmental process
GO:0060348	0.643	bone development
GO:0048583	0.630	regulation of response to stimulus
GO:0010605	0.615	negative regulation of macromolecule metabolic process
GO:0065009	0.607	regulation of molecular function
GO:0003170	0.564	heart valve development
GO:0045595	0.556	regulation of cell differentiation
GO:0042127	0.505	regulation of cell population proliferation
GO:0009891	0.493	positive regulation of biosynthetic process
GO:0042221	0.490	response to chemical
GO:0006357	0.484	regulation of transcription by RNA polymerase II
GO:0031328	0.478	positive regulation of cellular biosynthetic process
GO:0010941	0.470	regulation of cell death
GO:0031324	0.469	negative regulation of cellular metabolic process
GO:0010557	0.463	positive regulation of macromolecule biosynthetic process
GO:0051172	0.456	negative regulation of nitrogen compound metabolic process
GO:0009966	0.456	regulation of signal transduction
GO:0051254	0.456	positive regulation of RNA metabolic process
GO:1903508	0.453	positive regulation of nucleic acid-templated transcription
GO:0009887	0.451	animal organ morphogenesis
GO:0051240	0.450	positive regulation of multicellular organismal process
GO:0009790	0.449	embryo development
GO:0045893	0.438	positive regulation of DNA-templated transcription
GO:0060548	0.427	negative regulation of cell death
GO:0043067	0.426	regulation of programmed cell death
GO:0045944	0.409	positive regulation of transcription by RNA polymerase II
GO:2000026	0.404	regulation of multicellular organismal development
GO:0051093	0.403	negative regulation of developmental process
GO:0030154	0.395	cell differentiation
GO:0009719	0.379	response to endogenous stimulus
GO:0045596	0.375	negative regulation of cell differentiation
GO:0051246	0.361	regulation of protein metabolic process
GO:0007154	0.356	cell communication
GO:2000145	0.349	regulation of cell motility
GO:0023052	0.346	signaling
GO:0045597	0.346	positive regulation of cell differentiation
GO:0000122	0.335	negative regulation of transcription by RNA polymerase II
GO:0044093	0.334	positive regulation of molecular function
GO:0070887	0.322	cellular response to chemical stimulus
GO:1902531	0.311	regulation of intracellular signal transduction
GO:0006950	0.310	response to stress
GO:0071495	0.307	cellular response to endogenous stimulus
GO:2000147	0.306	positive regulation of cell motility
GO:0007165	0.305	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]