StarFunc result for job id Q15678

User Input

>input (1187 residues)
MPFGLKLRRTRRYNVLSKNCFVTRIRLLDSNVIECTLSVESTGQECLEAVAQRLELRETH
YFGLWFLSKSQQARWVELEKPLKKHLDKFANEPLLFFGVMFYVPNVSWLQQEATRYQYYL
QVKKDVLEGRLRCTLDQVIRLAGLAVQADFGDYNQFDSQDFLREYVLFPMDLALEEAVLE
ELTQKVAQEHKAHSGILPAEAELMYINEVERLDGFGQEIFPVKDNHGNCVHLGIFFMGIF
VRNRIGRQAVIYRWNDMGNITHNKSTILVELINKEETALFHTDDIENAKYISRLFATRHK
FYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPVHVQCGEHYSETHTSQDSIFH
GNEEALYCNSHNSLDLNYLNGTVTNGSVCSVHSVNSLNCSQSFIQASPVSSNLSIPGSDI
MRADYIPSHRHSAIIVPSYRPTPDYETVMRQMKRGILHTDSQSQSLRNLNIINTHAYNQP
EDLVYSQPEMRERHPYTVPYGPQGVYSNKLVSPSDQRNPKNNVVPSKPGASAISHTVSTP
ELANMQLQGSHNYSTAHMLKNYLFRPPPPYPRPRPATSTPDLASHRHKYVSGSSPDLVTR
KVQLSVKTFQEDSSPVVHQSLQEVSEPLTATKHHGTVNKRHSLEVMNSMVRGMEAMTLKS
LHLPMARRNTLREQGPPEEGSGSHEVPQLPQYHHKKTFSDATMLIHSSESEEEEEEAPES
VPQIPMLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQASLPPAMARARV
LRHGPAKAISMSRTDPPAVNGASLGPSISEPDLTSVKERVKKEPVKERPVSEMFSLEDSI
IEREMMIRNLEKQKMAGLEAQKRPLMLAALNGLSVARVSGREENRVDATRVPMDERFRTL
KKKLEEGMVFTEYEQIPKKKANGIFSTAALPENAERSRIREVVPYEENRVELIPTKENNT
GYINASHIKVVVGGAEWHYIATQGPLPHTCHDFWQMVWEQGVNVIAMVTAEEEGGRTKSH
RYWPKLGSKHSSATYGKFKVTTKFRTDSVCYATTGLKVKHLLSGQERTVWHLQYTDWPDH
GCPEDVQGFLSYLEEIQSVRRHTNSMLEGTKNRHPPIVVHCSAGVGRTGVLILSELMIYC
LEHNEKVEVPMMLRLLREQRMFMIQTIAQYKFVYQVLIQFLQNSRLI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q62130	0.545	0.544	0.000	1189	0.917	0.916	Q62130.pdb.gz	PTN14_MOUSE Tyrosine-protein phosphatase non-receptor type 14 OS=Mus musculus OX=10090 GN=Ptpn14 PE=1 SV=2
2	AFDB:Q62728	0.547	0.552	4.731E-102	1175	0.537	0.542	Q62728.pdb.gz	PTN21_RAT Tyrosine-protein phosphatase non-receptor type 21 OS=Rattus norvegicus OX=10116 GN=Ptpn21 PE=1 SV=1
3	AFDB:A0A286YBL8	0.479	0.473	6.715E-101	1204	0.521	0.513	A0A286YBL8.pdb.gz	A0A286YBL8_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=ptpn21 PE=3 SV=1
4	AFDB:Q16825	0.284	0.286	1.303E-100	1174	0.544	0.550	Q16825.pdb.gz	PTN21_HUMAN Tyrosine-protein phosphatase non-receptor type 21 OS=Homo sapiens OX=9606 GN=PTPN21 PE=1 SV=2
5	AFDB:F1Q6T9	0.409	0.414	1.850E-99	1168	0.516	0.525	F1Q6T9.pdb.gz	F1Q6T9_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=ptpn21 PE=3 SV=2
6	AFDB:O17905	0.217	0.236	5.912E-24	1091	0.153	0.167	O17905.pdb.gz	O17905_CAEEL Moesin/ezrin/radixin homolog 1 OS=Caenorhabditis elegans OX=6239 GN=frm-3 PE=1 SV=2
7	PDB:3ps5A	0.204	0.445	1.534E-22	529	0.085	0.191	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
8	AFDB:Q62656	0.219	0.114	4.080E-22	2316	0.152	0.078	Q62656.pdb.gz	PTPRZ_RAT Receptor-type tyrosine-protein phosphatase zeta OS=Rattus norvegicus OX=10116 GN=Ptprz1 PE=1 SV=1
9	PDB:4gwfA	0.216	0.498	1.066E-21	497	0.082	0.195	4gwfA.pdb.gz
10	AFDB:P23471	0.219	0.114	1.617E-21	2315	0.152	0.078	P23471.pdb.gz	PTPRZ_HUMAN Receptor-type tyrosine-protein phosphatase zeta OS=Homo sapiens OX=9606 GN=PTPRZ1 PE=1 SV=4
11	PDB:6krwA	0.210	0.764	4.448E-21	306	0.076	0.294	6krwA.pdb.gz
12	PDB:5xzrA	0.211	0.466	1.513E-20	519	0.088	0.200	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
13	PDB:4rm8A	0.227	0.699	1.106E-19	368	0.061	0.196	4rm8A.pdb.gz
14	PDB:3m4uA	0.204	0.790	2.856E-16	285	0.062	0.260	3m4uA.pdb.gz
15	AFDB:Q9VUH6	0.199	0.133	2.002E-15	1833	0.139	0.090	Q9VUH6.pdb.gz	Q9VUH6_DROME Myopic OS=Drosophila melanogaster OX=7227 GN=mop PE=1 SV=2
16	AFDB:Q14CM0	0.219	0.198	2.990E-14	1322	0.104	0.094	Q14CM0.pdb.gz	FRPD4_HUMAN FERM and PDZ domain-containing protein 4 OS=Homo sapiens OX=9606 GN=FRMPD4 PE=1 SV=1
17	PDB:7c3mA	0.183	0.363	3.644E-7	577	0.043	0.088	7c3mA.pdb.gz
18	PDB:6r9tA	0.122	0.071	9.127E-7	2185	0.029	0.016	6r9tA.pdb.gz
19	PDB:3pvuA	0.077	0.142	1.096E-3	609	0.019	0.038	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
20	PDB:5yqrA	0.081	0.292	3.041E-3	268	0.023	0.101	5yqrA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A286YBL8	0.0	1122	1204	0.532	0.525	A0A286YBL8_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=ptpn21 PE=3 SV=1
2	F1Q6T9	0.0	1134	1168	0.530	0.539	F1Q6T9_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=ptpn21 PE=3 SV=2
3	Q15678	0.0	2482	1187	1.000	1.000	PTN14_HUMAN Tyrosine-protein phosphatase non-receptor type 14 OS=Homo sapiens OX=9606 GN=PTPN14 PE=1 SV=2
4	Q16825	0.0	1166	1174	0.550	0.556	PTN21_HUMAN Tyrosine-protein phosphatase non-receptor type 21 OS=Homo sapiens OX=9606 GN=PTPN21 PE=1 SV=2
5	Q62130	0.0	2215	1189	0.916	0.914	PTN14_MOUSE Tyrosine-protein phosphatase non-receptor type 14 OS=Mus musculus OX=10090 GN=Ptpn14 PE=1 SV=2
6	Q62728	0.0	1165	1175	0.543	0.548	PTN21_RAT Tyrosine-protein phosphatase non-receptor type 21 OS=Rattus norvegicus OX=10116 GN=Ptpn21 PE=1 SV=1
7	Q562B7	2.58e-61	214	306	0.093	0.359	Q562B7_RAT Ptpn3 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Ptpn3 PE=2 SV=1
8	Q9V3V3	1.04e-59	227	1252	0.093	0.088	Q9V3V3_DROME Pez, isoform A OS=Drosophila melanogaster OX=7227 GN=Pez PE=2 SV=1
9	P26045	9.45e-58	218	913	0.093	0.120	PTN3_HUMAN Tyrosine-protein phosphatase non-receptor type 3 OS=Homo sapiens OX=9606 GN=PTPN3 PE=1 SV=2
10	A0A096MJA1	6.63e-57	216	967	0.093	0.114	A0A096MJA1_RAT Tyrosine-protein phosphatase non-receptor type OS=Rattus norvegicus OX=10116 GN=Ptpn3 PE=1 SV=2
11	A0A8I5ZUL2	9.24e-57	216	935	0.093	0.118	A0A8I5ZUL2_RAT Tyrosine-protein phosphatase non-receptor type OS=Rattus norvegicus OX=10116 GN=Ptpn3 PE=1 SV=1
12	A0A8I5YBL2	9.43e-57	215	932	0.093	0.118	A0A8I5YBL2_RAT Tyrosine-protein phosphatase non-receptor type OS=Rattus norvegicus OX=10116 GN=Ptpn3 PE=1 SV=1
13	F1LQQ5	1.14e-56	216	1018	0.093	0.108	F1LQQ5_RAT Tyrosine-protein phosphatase non-receptor type OS=Rattus norvegicus OX=10116 GN=Ptpn3 PE=3 SV=2
14	Q9WU22	5.47e-55	210	926	0.089	0.114	PTN4_MOUSE Tyrosine-protein phosphatase non-receptor type 4 OS=Mus musculus OX=10090 GN=Ptpn4 PE=1 SV=2
15	P29074	6.72e-55	209	926	0.089	0.114	PTN4_HUMAN Tyrosine-protein phosphatase non-receptor type 4 OS=Homo sapiens OX=9606 GN=PTPN4 PE=1 SV=1
16	P28191	9.75e-50	194	1026	0.094	0.109	PTP1_CAEEL Tyrosine-protein phosphatase 1 OS=Caenorhabditis elegans OX=6239 GN=ptp-1 PE=2 SV=3
17	Q4JDL3	3.62e-49	182	420	0.088	0.248	PTN20_HUMAN Tyrosine-protein phosphatase non-receptor type 20 OS=Homo sapiens OX=9606 GN=PTPN20 PE=1 SV=1
18	G3V9S3	9.96e-48	189	2460	0.100	0.048	G3V9S3_RAT Tyrosine-protein phosphatase non-receptor type 13 OS=Rattus norvegicus OX=10116 GN=Ptpn13 PE=1 SV=2
19	A0A0G2K1K1	1.01e-47	189	2445	0.100	0.049	A0A0G2K1K1_RAT Tyrosine-protein phosphatase non-receptor type 13 OS=Rattus norvegicus OX=10116 GN=Ptpn13 PE=1 SV=1
20	A0A8I6A6L8	1.02e-47	189	2266	0.100	0.053	A0A8I6A6L8_RAT Tyrosine-protein phosphatase non-receptor type 13 OS=Rattus norvegicus OX=10116 GN=Ptpn13 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	0.0054	28.0	Dual specificity phosphatase, catalytic domain
2	PF09380 FERM_C	0.00011	33.9	FERM C-terminal PH-like domain
3	PF00373 FERM_M	1.1e-18	79.1	FERM central domain
4	PF09379 FERM_N	5.8e-19	79.0	FERM N-terminal domain
5	PF14566 PTPlike_phytase	68	15.0	Inositol hexakisphosphate
6	PF00102 Y_phosphatase	3.7e-70	247.7	Protein-tyrosine phosphatase
7	PF13350 Y_phosphatase3	2.7	19.5	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355923

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000427772	0.994	Protein KIBRA
2	9606.ENSP00000478927	0.965	Transcriptional coactivator YAP1
3	9606.ENSP00000394794	0.959	Tyrosine-protein phosphatase non-receptor type 13
4	9606.ENSP00000311857	0.944	Tyrosine-protein phosphatase non-receptor type 2
5	9606.ENSP00000248594	0.931	Tyrosine-protein phosphatase non-receptor type 12
6	9606.ENSP00000265562	0.929	Tyrosine-protein phosphatase non-receptor type 23
7	9606.ENSP00000340944	0.928	Tyrosine-protein phosphatase non-receptor type 11
8	9606.ENSP00000309116	0.926	Tyrosine-protein phosphatase non-receptor type 7
9	9606.ENSP00000391592	0.923	Tyrosine-protein phosphatase non-receptor type 6
10	9606.ENSP00000351342	0.922	Tyrosine-protein phosphatase non-receptor type 5
11	9606.ENSP00000175756	0.919	Tyrosine-protein phosphatase non-receptor type 18
12	9606.ENSP00000263708	0.919	Tyrosine-protein phosphatase non-receptor type 4
13	9606.ENSP00000363459	0.917	Tyrosine-protein phosphatase non-receptor type 20
14	9606.ENSP00000482732	0.915	Tyrosine-protein phosphatase non-receptor type 9
15	9606.ENSP00000332973	0.907	Mothers against decapentaplegic homolog 3
16	9606.ENSP00000263326	0.900	Interleukin-37
17	9606.ENSP00000361027	0.810	Angiomotin
18	9606.ENSP00000437550	0.803	Serine/threonine-protein kinase LATS1
19	9606.ENSP00000370242	0.781	Protein WWC3
20	9606.ENSP00000427793	0.726	NEDD4-like E3 ubiquitin-protein ligase WWP1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004725	1.000	protein tyrosine phosphatase activity
GO:0019899	0.557	enzyme binding
GO:0019900	0.507	kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.986	cellular process
GO:0008152	0.959	metabolic process
GO:0001945	0.929	lymph vessel development
GO:0071704	0.918	organic substance metabolic process
GO:0050794	0.908	regulation of cellular process
GO:0006807	0.893	nitrogen compound metabolic process
GO:0044238	0.875	primary metabolic process
GO:0043170	0.865	macromolecule metabolic process
GO:0044237	0.864	cellular metabolic process
GO:1901564	0.844	organonitrogen compound metabolic process
GO:0019538	0.784	protein metabolic process
GO:0043412	0.707	macromolecule modification
GO:0009653	0.705	anatomical structure morphogenesis
GO:0036211	0.692	protein modification process
GO:0048519	0.689	negative regulation of biological process
GO:0006793	0.682	phosphorus metabolic process
GO:0036303	0.651	lymph vessel morphogenesis
GO:0006796	0.613	phosphate-containing compound metabolic process
GO:0048523	0.607	negative regulation of cellular process
GO:0001946	0.564	lymphangiogenesis
GO:0006470	0.546	protein dephosphorylation
GO:0050896	0.377	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.995	cytoplasm
GO:0005829	0.884	cytosol
GO:0016020	0.874	membrane
GO:0043228	0.667	non-membrane-bounded organelle
GO:0043232	0.647	intracellular non-membrane-bounded organelle
GO:0071944	0.407	cell periphery
GO:0005886	0.400	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	1.000	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	1.000	protein-tyrosine-phosphatase.

[back to server]