StarFunc result for job id Q15691

User Input

>input (268 residues)
MAVNVYSTSVTSDNLSRHDMLAWINESLQLNLTKIEQLCSGAAYCQFMDMLFPGSIALKK
VKFQAKLEHEYIQNFKILQAGFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYD
GKDYDPVAARQGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVV
RKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQ
RIVDILYATDEGFVIPDEGGPQEEQEEY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15691	1.000	1.000	3.910E-38	268	1.000	1.000	Q15691.pdb.gz	MARE1_HUMAN Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3
2	AFDB:Q9W6M6	0.590	0.612	2.740E-30	258	0.784	0.814	Q9W6M6.pdb.gz	Q9W6M6_ICTPU EB1 OS=Ictalurus punctatus OX=7998 GN=mapre1b PE=2 SV=1
3	AFDB:Q5XIT1	0.598	0.572	1.925E-27	281	0.653	0.623	Q5XIT1.pdb.gz	MARE3_RAT Microtubule-associated protein RP/EB family member 3 OS=Rattus norvegicus OX=10116 GN=Mapre3 PE=1 SV=1
4	AFDB:Q15555	0.569	0.471	5.627E-25	327	0.571	0.468	Q15555.pdb.gz	MARE2_HUMAN Microtubule-associated protein RP/EB family member 2 OS=Homo sapiens OX=9606 GN=MAPRE2 PE=1 SV=1
5	AFDB:A1Z6P3	0.536	0.485	2.935E-24	297	0.575	0.519	A1Z6P3.pdb.gz	A1Z6P3_DROME Eb1, isoform F OS=Drosophila melanogaster OX=7227 GN=Eb1 PE=1 SV=2
6	AFDB:Q7JZD3	0.616	0.575	4.212E-24	291	0.575	0.529	Q7JZD3.pdb.gz	Q7JZD3_DROME Eb1, isoform A OS=Drosophila melanogaster OX=7227 GN=Eb1 PE=1 SV=1
7	AFDB:A7MC00	0.564	0.447	1.981E-23	343	0.578	0.452	A7MC00.pdb.gz	A7MC00_DANRE Microtubule-associated protein RP/EB family member 2 OS=Danio rerio OX=7955 GN=mapre2 PE=1 SV=1
8	AFDB:Q9GRZ1	0.495	0.420	5.908E-20	316	0.500	0.424	Q9GRZ1.pdb.gz	Q9GRZ1_CAEEL Microtubule End Binding Protein OS=Caenorhabditis elegans OX=6239 GN=ebp-1 PE=1 SV=1
9	PDB:2r8uB	0.484	0.946	4.750E-18	136	0.493	0.971	2r8uB.pdb.gz	Structure of fragment of human end-binding protein 1 (EB1) containing the N-terminal domain at 1.35 A resolution
10	AFDB:Q9FJJ5	0.506	0.471	3.821E-16	293	0.369	0.338	Q9FJJ5.pdb.gz	EB1B_ARATH Microtubule-associated protein RP/EB family member 1B OS=Arabidopsis thaliana OX=3702 GN=EB1B PE=1 SV=1
11	AFDB:Q7XJ60	0.488	0.474	7.098E-16	276	0.358	0.348	Q7XJ60.pdb.gz	EB1A_ARATH Microtubule-associated protein RP/EB family member 1A OS=Arabidopsis thaliana OX=3702 GN=EB1A PE=1 SV=1
12	PDB:7sj9M	0.481	0.973	1.018E-15	131	0.422	0.863	7sj9M.pdb.gz	Structural transitions in the GTP cap visualized by cryo-electron microscopy of catalytically inactive microtubules.
13	PDB:7n6g6A	0.280	0.055	8.649E-1	1558	0.075	0.013	7n6g6A.pdb.gz	Cryo-EM structure of an active central apparatus.
14	PDB:7sx8D	0.323	0.202	1.120	448	0.071	0.042	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
15	PDB:4cniC	0.113	0.147	1.781	171	0.071	0.111	4cniC.pdb.gz
16	PDB:6o4oA	0.121	0.160	1.781	169	0.037	0.059	6o4oA.pdb.gz
17	PDB:6zh5A	0.099	0.125	2.080	178	0.060	0.090	6zh5A.pdb.gz
18	PDB:7vvuT	0.171	0.168	2.080	274	0.146	0.142	7vvuT.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
19	PDB:6gs1A	0.099	0.068	2.306	472	0.071	0.040	6gs1A.pdb.gz
20	PDB:7k26D	0.089	0.125	2.557	176	0.063	0.097	7k26D.pdb.gz	Anisotropic Dynamics and Mechanics of Macromolecular Crystals Containing Lattice-Patterned Polymer Networks.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15691	0.0	554	268	1.000	1.000	MARE1_HUMAN Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3
2	Q61166	0.0	541	268	0.970	0.970	MARE1_MOUSE Microtubule-associated protein RP/EB family member 1 OS=Mus musculus OX=10090 GN=Mapre1 PE=1 SV=3
3	Q66HR2	0.0	538	268	0.966	0.966	MARE1_RAT Microtubule-associated protein RP/EB family member 1 OS=Rattus norvegicus OX=10116 GN=Mapre1 PE=1 SV=3
4	Q9W6M6	3.42e-149	419	258	0.784	0.814	Q9W6M6_ICTPU EB1 OS=Ictalurus punctatus OX=7998 GN=mapre1b PE=2 SV=1
5	Q5XIT1	5.03e-124	356	281	0.694	0.662	MARE3_RAT Microtubule-associated protein RP/EB family member 3 OS=Rattus norvegicus OX=10116 GN=Mapre3 PE=1 SV=1
6	Q6PER3	5.03e-124	356	281	0.694	0.662	MARE3_MOUSE Microtubule-associated protein RP/EB family member 3 OS=Mus musculus OX=10090 GN=Mapre3 PE=1 SV=1
7	Q9UPY8	5.93e-124	356	281	0.687	0.655	MARE3_HUMAN Microtubule-associated protein RP/EB family member 3 OS=Homo sapiens OX=9606 GN=MAPRE3 PE=1 SV=1
8	Q9XZ57	3.32e-106	311	290	0.578	0.534	Q9XZ57_DROME Eb1, isoform E OS=Drosophila melanogaster OX=7227 GN=Eb1 PE=1 SV=1
9	Q15555	4.07e-106	312	327	0.563	0.462	MARE2_HUMAN Microtubule-associated protein RP/EB family member 2 OS=Homo sapiens OX=9606 GN=MAPRE2 PE=1 SV=1
10	Q7JZD3	2.62e-105	309	291	0.582	0.536	Q7JZD3_DROME Eb1, isoform A OS=Drosophila melanogaster OX=7227 GN=Eb1 PE=1 SV=1
11	Q8R001	4.03e-105	310	326	0.556	0.457	MARE2_MOUSE Microtubule-associated protein RP/EB family member 2 OS=Mus musculus OX=10090 GN=Mapre2 PE=1 SV=1
12	A1Z6P3	5.71e-104	306	297	0.571	0.515	A1Z6P3_DROME Eb1, isoform F OS=Drosophila melanogaster OX=7227 GN=Eb1 PE=1 SV=2
13	A7MC00	5.22e-100	297	343	0.560	0.437	A7MC00_DANRE Microtubule-associated protein RP/EB family member 2 OS=Danio rerio OX=7955 GN=mapre2 PE=1 SV=1
14	Q9GRZ1	2.17e-80	246	316	0.496	0.421	Q9GRZ1_CAEEL Microtubule End Binding Protein OS=Caenorhabditis elegans OX=6239 GN=ebp-1 PE=1 SV=1
15	Q9FJJ5	2.35e-57	187	293	0.381	0.348	EB1B_ARATH Microtubule-associated protein RP/EB family member 1B OS=Arabidopsis thaliana OX=3702 GN=EB1B PE=1 SV=1
16	Q7XJ60	6.22e-51	170	276	0.340	0.330	EB1A_ARATH Microtubule-associated protein RP/EB family member 1A OS=Arabidopsis thaliana OX=3702 GN=EB1A PE=1 SV=1
17	Q9FGQ6	9.30e-50	168	329	0.340	0.277	EB1C_ARATH Microtubule-associated protein RP/EB family member 1C OS=Arabidopsis thaliana OX=3702 GN=EB1C PE=1 SV=1
18	P40013	4.22e-44	154	344	0.377	0.294	BIM1_YEAST Protein BIM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BIM1 PE=1 SV=1
19	Q9XXA2	3.82e-42	147	299	0.351	0.314	Q9XXA2_CAEEL Calponin homology domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ebp-2 PE=1 SV=1
20	Q10113	7.21e-42	147	308	0.343	0.299	MAL3_SCHPO Microtubule integrity protein mal3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mal3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11971 CAMSAP_CH	24	16.2	CAMSAP CH domain
2	PF00307 CH	2.9e-11	54.9	Calponin homology (CH) domain
3	PF03271 EB1	1.1e-14	65.7	EB1-like C-terminal motif
4	PF16619 SUIM_assoc	4.6e+02	12.2	Unstructured region C-term to UIM in Ataxin3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364721

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000479322	0.994	CAP-Gly domain-containing linker protein 1
2	9606.ENSP00000233121	0.992	Microtubule-associated protein RP/EB family member 3
3	9606.ENSP00000354791	0.990	Dynactin subunit 1
4	9606.ENSP00000307959	0.986	Dystonin
5	9606.ENSP00000361298	0.964	Kinesin-like protein KIF2C
6	9606.ENSP00000417518	0.959	CLIP-associating protein 2
7	9606.ENSP00000478059	0.957	Stromal interaction molecule 1
8	9606.ENSP00000432768	0.945	Cytoskeleton-associated protein 5
9	9606.ENSP00000257430	0.938	Adenomatous polyposis coli protein
10	9606.ENSP00000256442	0.924	G2/mitotic-specific cyclin-B1
11	9606.ENSP00000288207	0.922	G2/mitotic-specific cyclin-B2
12	9606.ENSP00000282561	0.919	Gap junction alpha-1 protein
13	9606.ENSP00000358363	0.914	Myomegalin
14	9606.ENSP00000348573	0.894	A-kinase anchor protein 9
15	9606.ENSP00000300249	0.892	Microtubule-associated protein RP/EB family member 2
16	9606.ENSP00000354573	0.889	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5
17	9606.ENSP00000380378	0.886	Platelet-activating factor acetylhydrolase IB subunit alpha
18	9606.ENSP00000265148	0.881	Centromere-associated protein E
19	9606.ENSP00000403902	0.865	RelA-associated inhibitor
20	9606.ENSP00000313950	0.862	Aurora kinase B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051010	1.000	microtubule plus-end binding
GO:0042802	0.865	identical protein binding
GO:0019899	0.859	enzyme binding
GO:0019900	0.578	kinase binding
GO:0019901	0.533	protein kinase binding
GO:1901363	0.400	heterocyclic compound binding
GO:0097159	0.400	organic cyclic compound binding
GO:0003676	0.307	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0065007	0.984	biological regulation
GO:0016043	0.983	cellular component organization
GO:0072698	0.967	protein localization to microtubule cytoskeleton
GO:0050794	0.952	regulation of cellular process
GO:0051098	0.906	regulation of binding
GO:0031109	0.894	microtubule polymerization or depolymerization
GO:1902903	0.880	regulation of supramolecular fiber organization
GO:0070925	0.878	organelle assembly
GO:0051656	0.864	establishment of organelle localization
GO:0051258	0.863	protein polymerization
GO:0044093	0.860	positive regulation of molecular function
GO:0097435	0.851	supramolecular fiber organization
GO:0043254	0.847	regulation of protein-containing complex assembly
GO:0098813	0.841	nuclear chromosome segregation
GO:0070507	0.840	regulation of microtubule cytoskeleton organization
GO:1902850	0.827	microtubule cytoskeleton organization involved in mitosis
GO:0000070	0.826	mitotic sister chromatid segregation
GO:0048518	0.820	positive regulation of biological process
GO:0048522	0.786	positive regulation of cellular process
GO:0031110	0.783	regulation of microtubule polymerization or depolymerization
GO:0032271	0.769	regulation of protein polymerization
GO:0031113	0.750	regulation of microtubule polymerization
GO:0051649	0.746	establishment of localization in cell
GO:0051653	0.734	spindle localization
GO:0051293	0.707	establishment of spindle localization
GO:1905508	0.678	protein localization to microtubule organizing center
GO:0007163	0.664	establishment or maintenance of cell polarity
GO:0048519	0.616	negative regulation of biological process
GO:0048523	0.592	negative regulation of cellular process
GO:0051130	0.584	positive regulation of cellular component organization
GO:0040001	0.539	establishment of mitotic spindle localization
GO:0046785	0.535	microtubule polymerization
GO:0051310	0.496	metaphase plate congression
GO:0019222	0.427	regulation of metabolic process
GO:0030031	0.422	cell projection assembly
GO:0007080	0.416	mitotic metaphase plate congression
GO:0060255	0.404	regulation of macromolecule metabolic process
GO:0044089	0.399	positive regulation of cellular component biogenesis
GO:0031334	0.367	positive regulation of protein-containing complex assembly
GO:0010638	0.352	positive regulation of organelle organization
GO:0051495	0.327	positive regulation of cytoskeleton organization
GO:0032273	0.323	positive regulation of protein polymerization
GO:0050896	0.321	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005874	0.999	microtubule
GO:0071944	0.996	cell periphery
GO:0016020	0.994	membrane
GO:1990752	0.981	microtubule end
GO:0043227	0.968	membrane-bounded organelle
GO:0005886	0.963	plasma membrane
GO:0005815	0.832	microtubule organizing center
GO:0005634	0.830	nucleus
GO:0005819	0.825	spindle
GO:0005829	0.804	cytosol
GO:0005813	0.641	centrosome
GO:0005876	0.641	spindle microtubule
GO:0035371	0.534	microtubule plus-end
GO:0042995	0.525	cell projection
GO:0120025	0.502	plasma membrane bounded cell projection
GO:0005881	0.480	cytoplasmic microtubule
GO:0012505	0.472	endomembrane system
GO:0032991	0.324	protein-containing complex
GO:0070161	0.313	anchoring junction
GO:0005925	0.302	focal adhesion
GO:0072686	0.301	mitotic spindle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]