StarFunc result for job id Q15697

User Input

>input (407 residues)
MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGP
QEALSQLRQLCRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTL
VEDFHRASKKPKQWVAVCMQGQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQ
AGAYDRLSPHHWEKSPLLQEPTPKLAGTEAPRMRSDNKENPQQEGAKGAKPCAVSAGRSK
GNGLQNPEPRGANMSEPRLSRRQVSSPNAQKPFAHYQRHCRVEYISSPLKSHPLRELKKS
KGGKRSLSNRLQHLGHQPTRSAKKPYKCDDCGKSFTWNSELKRHKRVHTGERPYTCGECG
NCFGRQSTLKLHQRIHTGEKPYQCGQCGKSFRQSSNLHQHHRLHHGD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15697	1.000	1.000	2.647E-66	407	1.000	1.000	Q15697.pdb.gz	ZN174_HUMAN Zinc finger protein 174 OS=Homo sapiens OX=9606 GN=ZNF174 PE=1 SV=1
2	AFDB:A0A024R4T5	0.232	0.133	1.501E-24	734	0.366	0.203	A0A024R4T5.pdb.gz
3	AFDB:O60304	0.231	0.198	4.038E-24	480	0.346	0.294	O60304.pdb.gz	ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens OX=9606 GN=ZNF500 PE=1 SV=2
4	AFDB:Q9P0L1	0.237	0.133	3.110E-23	754	0.346	0.187	Q9P0L1.pdb.gz	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
5	AFDB:Q8NF99	0.247	0.193	7.868E-23	534	0.317	0.242	Q8NF99.pdb.gz	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
6	AFDB:A0A024R3M3	0.217	0.138	1.653E-22	648	0.354	0.222	A0A024R3M3.pdb.gz
7	AFDB:Q3ZBY5	0.236	0.209	1.653E-22	466	0.297	0.260	Q3ZBY5.pdb.gz	Q3ZBY5_BOVIN Zinc finger and SCAN domain containing 21 OS=Bos taurus OX=9913 GN=ZSCAN21 PE=2 SV=1
8	AFDB:Q53GI3	0.236	0.174	2.117E-22	561	0.356	0.258	Q53GI3.pdb.gz	ZN394_HUMAN Zinc finger protein 394 OS=Homo sapiens OX=9606 GN=ZNF394 PE=1 SV=2
9	AFDB:Q6NSZ9	0.245	0.189	4.668E-21	544	0.324	0.243	Q6NSZ9.pdb.gz	ZSC25_HUMAN Zinc finger and SCAN domain-containing protein 25 OS=Homo sapiens OX=9606 GN=ZSCAN25 PE=1 SV=3
10	AFDB:Q96N95	0.247	0.293	6.767E-21	335	0.300	0.364	Q96N95.pdb.gz	ZN396_HUMAN Zinc finger protein 396 OS=Homo sapiens OX=9606 GN=ZNF396 PE=1 SV=2
11	PDB:6ydhA	0.051	0.208	6.340E-1	62	0.032	0.210	6ydhA.pdb.gz
12	PDB:7r24A	0.089	0.211	1.706	150	0.037	0.100	7r24A.pdb.gz
13	PDB:3lkuE	0.080	0.103	2.054	291	0.027	0.038	3lkuE.pdb.gz	Structural characterization of the Get4/Get5 complex and its interaction with Get3.
14	PDB:7ajuUK	0.071	0.130	2.054	219	0.049	0.091	7ajuUK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
15	PDB:6cmoA	0.075	0.084	2.325	354	0.071	0.082	6cmoA.pdb.gz
16	PDB:1serB	0.075	0.073	2.977	421	0.049	0.048	1serB.pdb.gz	The 2.9 A crystal structure of T. thermophilus seryl-tRNA synthetase complexed with tRNA(Ser).
17	PDB:2ehjA	0.062	0.110	3.369	208	0.015	0.029	2ehjA.pdb.gz
18	PDB:6qw65B	0.071	0.020	3.369	2001	0.047	0.009	6qw65B.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
19	PDB:7oyaE1	0.035	0.063	3.369	206	0.020	0.039	7oyaE1.pdb.gz	A molecular network of conserved factors keeps ribosomes dormant in the egg.
20	PDB:7z8bC	0.102	0.045	3.369	1224	0.042	0.014	7z8bC.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15697	0.0	835	407	1.000	1.000	ZN174_HUMAN Zinc finger protein 174 OS=Homo sapiens OX=9606 GN=ZNF174 PE=1 SV=1
2	Q91VN1	1.43e-65	215	368	0.371	0.410	ZNF24_MOUSE Zinc finger protein 24 OS=Mus musculus OX=10090 GN=Znf24 PE=1 SV=1
3	Q9Y5A6	1.65e-65	218	473	0.373	0.321	ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZSCAN21 PE=1 SV=2
4	Q07231	9.65e-65	218	555	0.378	0.277	ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus OX=10090 GN=Zscan21 PE=2 SV=2
5	Q3MJ62	9.72e-65	214	389	0.354	0.370	ZSC23_HUMAN Zinc finger and SCAN domain-containing protein 23 OS=Homo sapiens OX=9606 GN=ZSCAN23 PE=1 SV=1
6	O43309	3.13e-63	215	611	0.361	0.241	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
7	Q8NF99	1.13e-62	212	534	0.354	0.270	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
8	Q3ZBY5	4.79e-62	209	466	0.361	0.315	Q3ZBY5_BOVIN Zinc finger and SCAN domain containing 21 OS=Bos taurus OX=9913 GN=ZSCAN21 PE=2 SV=1
9	O60304	2.50e-61	207	480	0.403	0.342	ZN500_HUMAN Zinc finger protein 500 OS=Homo sapiens OX=9606 GN=ZNF500 PE=1 SV=2
10	Q9P0L1	1.26e-60	211	754	0.408	0.220	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
11	A0A0S2Z658	1.35e-59	204	545	0.366	0.273	A0A0S2Z658_HUMAN Zinc finger with KRAB and SCAN domains 4 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=2 SV=1
12	Q969J2	1.35e-59	204	545	0.366	0.273	ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=1 SV=1
13	Q86W11	4.37e-59	202	494	0.351	0.289	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
14	Q9H4T2	5.07e-59	197	348	0.324	0.379	ZSC16_HUMAN Zinc finger and SCAN domain-containing protein 16 OS=Homo sapiens OX=9606 GN=ZSCAN16 PE=1 SV=2
15	Q96LW9	2.56e-58	197	406	0.354	0.355	ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens OX=9606 GN=ZSCAN31 PE=1 SV=2
16	Q9BRR0	3.47e-58	200	538	0.386	0.292	ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens OX=9606 GN=ZKSCAN3 PE=1 SV=2
17	P10073	5.96e-58	199	491	0.349	0.289	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
18	Q53GI3	9.99e-58	199	561	0.361	0.262	ZN394_HUMAN Zinc finger protein 394 OS=Homo sapiens OX=9606 GN=ZNF394 PE=1 SV=2
19	Q15776	4.14e-57	198	578	0.369	0.260	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2
20	P49910	8.82e-57	195	485	0.354	0.297	ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens OX=9606 GN=ZNF165 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	2.2e+02	13.1	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF09237 GAGA	9.8e+02	11.2	GAGA factor
3	PF17406 Nrap_D5	5.9e+02	11.6	Nrap protein PAP/OAS1-like domain 5
4	PF02023 SCAN	2.4e-37	138.0	SCAN domain
5	PF00096 zf-C2H2	1.6e-11	55.1	Zinc finger, C2H2 type
6	PF16622 zf-C2H2_11	18	16.5	zinc-finger C2H2-type
7	PF13894 zf-C2H2_4	0.23	23.4	C2H2-type zinc finger
8	PF13465 zf-H2C2_2	6.5e-11	53.4	Zinc-finger double domain
9	PF13909 zf-H2C2_5	1.1e+02	13.9	C2H2-type zinc-finger domain
10	PF13451 zf-trcl	2e+02	13.3	Probable zinc-ribbon domain
11	PF09723 Zn-ribbon_8	7.2e+02	11.7	Zinc ribbon domain
12	PF17283 Zn_ribbon_SprT	12	17.3	SprT-like zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268655

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380057	0.892	Zinc finger and SCAN domain-containing protein 32
2	9606.ENSP00000302310	0.840	Zinc finger protein 396
3	9606.ENSP00000331577	0.825	Zinc finger protein 397
4	9606.ENSP00000261332	0.807	Zinc finger protein 24
5	9606.ENSP00000338860	0.734	Zinc finger protein 444
6	9606.ENSP00000282326	0.696	Zinc finger and SCAN domain-containing protein 1
7	9606.ENSP00000366509	0.693	Zinc finger protein with KRAB and SCAN domains 4
8	9606.ENSP00000355053	0.692	Zinc finger and SCAN domain-containing protein 20
9	9606.ENSP00000259883	0.684	PiggyBac transposable element-derived protein 1
10	9606.ENSP00000470123	0.658	Zinc finger and SCAN domain-containing protein 18
11	9606.ENSP00000250076	0.647	Zinc finger protein 232
12	9606.ENSP00000311679	0.623	Zinc finger protein 483
13	9606.ENSP00000315664	0.615	Zinc finger protein 18
14	9606.ENSP00000318085	0.549	Histone H4 transcription factor
15	9606.ENSP00000432561	0.539	Histatin-3
16	9606.ENSP00000355929	0.531	Angel homolog 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	0.998	identical protein binding
GO:1990837	0.998	sequence-specific double-stranded DNA binding
GO:0046983	0.957	protein dimerization activity
GO:0042803	0.945	protein homodimerization activity
GO:0140110	0.939	transcription regulator activity
GO:0003700	0.934	DNA-binding transcription factor activity
GO:0001067	0.885	transcription regulatory region nucleic acid binding
GO:0000976	0.882	transcription cis-regulatory region binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0060255	0.987	regulation of macromolecule metabolic process
GO:0080090	0.985	regulation of primary metabolic process
GO:0051171	0.985	regulation of nitrogen compound metabolic process
GO:0010468	0.983	regulation of gene expression
GO:0031323	0.980	regulation of cellular metabolic process
GO:0019219	0.967	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.946	negative regulation of biological process
GO:0051252	0.945	regulation of RNA metabolic process
GO:0048523	0.935	negative regulation of cellular process
GO:0006355	0.919	regulation of DNA-templated transcription
GO:0010605	0.887	negative regulation of macromolecule metabolic process
GO:0045892	0.875	negative regulation of DNA-templated transcription
GO:0006357	0.734	regulation of transcription by RNA polymerase II
GO:0000122	0.557	negative regulation of transcription by RNA polymerase II
GO:0009987	0.464	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.998	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0043232	0.950	intracellular non-membrane-bounded organelle
GO:0016604	0.844	nuclear body
GO:0005737	0.802	cytoplasm
GO:0005730	0.802	nucleolus
GO:0001650	0.755	fibrillar center
GO:0005829	0.341	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]