StarFunc result for job id Q15699

User Input

>input (326 residues)
MEFLSEKFALKSPPSKNSDFYMGAGGPLEHVMETLDNESFYSKASAGKCVQAFGPLPRAE
HHVRLERTSPCQDSSVNYGITKVEGQPLHTELNRAMDNCNSLRMSPVKGMQEKGELDELG
DKCDSNVSSSKKRRHRTTFTSLQLEELEKVFQKTHYPDVYVREQLALRTELTEARVQVWF
QNRRAKWRKRERYGQIQQAKSHFAATYDISVLPRTDSYPQIQNNLWAGNASGGSVVTSCM
LPRDTSSCMTPYSHSPRTDSSYTGFSNHQNQFSHVPLNNFFTDSLLTGATNGHAFETKPE
FERRSSSIAVLRMKAKEHTANISWAM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15699	0.999	0.999	3.628E-47	326	1.000	1.000	Q15699.pdb.gz	ALX1_HUMAN ALX homeobox protein 1 OS=Homo sapiens OX=9606 GN=ALX1 PE=1 SV=2
2	AFDB:Q1LVQ7	0.503	0.511	3.519E-31	320	0.715	0.728	Q1LVQ7.pdb.gz	ALX1_DANRE ALX homeobox protein 1 OS=Danio rerio OX=7955 GN=alx1 PE=2 SV=1
3	AFDB:O70137	0.258	0.246	6.560E-14	343	0.374	0.356	O70137.pdb.gz	ALX3_MOUSE Homeobox protein aristaless-like 3 OS=Mus musculus OX=10090 GN=Alx3 PE=2 SV=1
4	AFDB:A6YP92	0.229	0.140	1.542E-12	566	0.344	0.198	A6YP92.pdb.gz	ARX_RAT Homeobox protein ARX OS=Rattus norvegicus OX=10116 GN=Arx PE=2 SV=1
5	AFDB:O42356	0.286	0.283	5.525E-12	330	0.270	0.267	O42356.pdb.gz	RX1_DANRE Retinal homeobox protein Rx1 OS=Danio rerio OX=7955 GN=rx1 PE=2 SV=2
6	AFDB:O42357	0.252	0.252	3.876E-11	327	0.270	0.269	O42357.pdb.gz	RX2_DANRE Retinal homeobox protein Rx2 OS=Danio rerio OX=7955 GN=rx2 PE=2 SV=1
7	AFDB:Q9Y2V3	0.285	0.270	1.943E-10	346	0.282	0.266	Q9Y2V3.pdb.gz	RX_HUMAN Retinal homeobox protein Rx OS=Homo sapiens OX=9606 GN=RAX PE=1 SV=2
8	AFDB:Q9W5Z2	0.253	0.261	3.326E-10	314	0.267	0.277	Q9W5Z2.pdb.gz	PITX2_DANRE Pituitary homeobox 2 OS=Danio rerio OX=7955 GN=pitx2 PE=2 SV=1
9	AFDB:Q6QU75	0.258	0.283	6.087E-10	293	0.270	0.300	Q6QU75.pdb.gz	PITX3_DANRE Pituitary homeobox 3 OS=Danio rerio OX=7955 GN=pitx3 PE=2 SV=1
10	AFDB:O35602	0.265	0.254	7.964E-10	342	0.248	0.237	O35602.pdb.gz	RX_MOUSE Retinal homeobox protein Rx OS=Mus musculus OX=10090 GN=Rax PE=2 SV=2
11	PDB:4egcA	0.153	0.092	1.945E-2	539	0.049	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.156	0.604	4.657E-2	73	0.067	0.301	2hi3A.pdb.gz
13	PDB:7fbyA	0.116	0.223	1.339	153	0.021	0.046	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:5mrca	0.108	0.185	1.432	177	0.046	0.085	5mrca.pdb.gz	The structure of the yeast mitochondrial ribosome.
15	PDB:4ldzA	0.147	0.231	2.291	196	0.025	0.041	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
16	PDB:7b93E	0.075	0.104	2.451	215	0.025	0.037	7b93E.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
17	PDB:5aj0BZ	0.126	0.394	3.206	86	0.034	0.128	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
18	PDB:7qggj	0.092	0.206	3.667	104	0.064	0.202	7qggj.pdb.gz	Neuronal RNA granules are ribosome complexes stalled at the pre-translocation state.
19	PDB:5nr5A	0.120	0.311	4.798	113	0.021	0.062	5nr5A.pdb.gz
20	PDB:6oajB	0.099	0.377	5.487	79	0.015	0.063	6oajB.pdb.gz	Nucleoid remodeling during environmental adaptation is regulated by HU-dependent DNA bundling.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15699	0.0	689	326	1.000	1.000	ALX1_HUMAN ALX homeobox protein 1 OS=Homo sapiens OX=9606 GN=ALX1 PE=1 SV=2
2	Q63087	0.0	664	326	0.960	0.960	ALX1_RAT ALX homeobox protein 1 OS=Rattus norvegicus OX=10116 GN=Alx1 PE=1 SV=1
3	Q8C8B0	0.0	672	326	0.972	0.972	ALX1_MOUSE ALX homeobox protein 1 OS=Mus musculus OX=10090 GN=Alx1 PE=1 SV=1
4	V9HWA7	0.0	689	326	1.000	1.000	V9HWA7_HUMAN Cartilage paired-class homeoprotein 1 OS=Homo sapiens OX=9606 GN=HEL23 PE=2 SV=1
5	Q1LVQ7	6.09e-159	448	320	0.715	0.728	ALX1_DANRE ALX homeobox protein 1 OS=Danio rerio OX=7955 GN=alx1 PE=2 SV=1
6	Q9H161	1.14e-75	239	411	0.377	0.299	ALX4_HUMAN Homeobox protein aristaless-like 4 OS=Homo sapiens OX=9606 GN=ALX4 PE=1 SV=2
7	O35137	9.15e-75	237	399	0.377	0.308	ALX4_MOUSE Homeobox protein aristaless-like 4 OS=Mus musculus OX=10090 GN=Alx4 PE=1 SV=1
8	Q6RW14	1.20e-67	217	343	0.344	0.327	Q6RW14_RAT Aristaless-related ALX3 OS=Rattus norvegicus OX=10116 GN=Alx3 PE=2 SV=1
9	O70137	3.46e-66	213	343	0.334	0.318	ALX3_MOUSE Homeobox protein aristaless-like 3 OS=Mus musculus OX=10090 GN=Alx3 PE=2 SV=1
10	O95076	7.67e-65	209	343	0.331	0.315	ALX3_HUMAN Homeobox protein aristaless-like 3 OS=Homo sapiens OX=9606 GN=ALX3 PE=1 SV=2
11	A6YP92	4.52e-35	135	566	0.282	0.163	ARX_RAT Homeobox protein ARX OS=Rattus norvegicus OX=10116 GN=Arx PE=2 SV=1
12	Q96QS3	5.28e-35	135	562	0.282	0.164	ARX_HUMAN Homeobox protein ARX OS=Homo sapiens OX=9606 GN=ARX PE=1 SV=1
13	O35085	7.99e-35	135	564	0.282	0.163	ARX_MOUSE Homeobox protein ARX OS=Mus musculus OX=10090 GN=Arx PE=1 SV=3
14	Q8T0V5	1.87e-29	117	357	0.169	0.154	Q8T0V5_DROME GH01528p OS=Drosophila melanogaster OX=7227 GN=Pph13 PE=2 SV=1
15	Q9XZU0	1.93e-29	117	357	0.169	0.154	Q9XZU0_DROME FI01102p OS=Drosophila melanogaster OX=7227 GN=Pph13 PE=2 SV=1
16	O42115	5.39e-29	117	453	0.160	0.115	ARX_DANRE Aristaless-related homeobox protein OS=Danio rerio OX=7955 GN=arx PE=2 SV=1
17	O42356	1.10e-28	114	330	0.245	0.242	RX1_DANRE Retinal homeobox protein Rx1 OS=Danio rerio OX=7955 GN=rx1 PE=2 SV=2
18	Q6QU75	2.28e-28	113	293	0.236	0.263	PITX3_DANRE Pituitary homeobox 3 OS=Danio rerio OX=7955 GN=pitx3 PE=2 SV=1
19	Q0P031	4.03e-28	113	344	0.166	0.157	VSX1_XENLA Visual system homeobox 1 OS=Xenopus laevis OX=8355 GN=vsx1 PE=2 SV=1
20	Q9W5Z2	5.93e-28	112	314	0.202	0.210	PITX2_DANRE Pituitary homeobox 2 OS=Danio rerio OX=7955 GN=pitx2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	4.6	18.6	Homeobox KN domain
2	PF00046 Homeodomain	2.7e-20	83.3	Homeodomain
3	PF03826 OAR	7.9e-06	36.7	OAR motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000315417

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000428603	0.621	Protocadherin gamma-B6
2	9606.ENSP00000330284	0.570	Neuropeptides B/W receptor type 1
3	9606.ENSP00000253699	0.558	Rabenosyn-5
4	9606.ENSP00000479153	0.553	EH domain-containing protein 1
5	9606.ENSP00000252505	0.548	Probable allantoicase
6	9606.ENSP00000376436	0.540	Protein C-ets-1
7	9606.ENSP00000361868	0.532	Zinc finger matrin-type 1
8	9606.ENSP00000362340	0.523	Neurochondrin
9	9606.ENSP00000441235	0.522	Thyrotropin receptor
10	9606.ENSP00000207157	0.521	T-box transcription factor TBX15
11	9606.ENSP00000302297	0.510	Leucine-rich repeat LGI family member 3
12	9606.ENSP00000248098	0.503	Jupiter microtubule associated homolog 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.996	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.988	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.514	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0019222	0.996	regulation of metabolic process
GO:0050794	0.994	regulation of cellular process
GO:0009889	0.991	regulation of biosynthetic process
GO:0032501	0.979	multicellular organismal process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0048856	0.975	anatomical structure development
GO:0031323	0.971	regulation of cellular metabolic process
GO:0010468	0.971	regulation of gene expression
GO:0007275	0.970	multicellular organism development
GO:0051171	0.968	regulation of nitrogen compound metabolic process
GO:0080090	0.967	regulation of primary metabolic process
GO:0048518	0.965	positive regulation of biological process
GO:0048731	0.961	system development
GO:0006355	0.950	regulation of DNA-templated transcription
GO:0048522	0.944	positive regulation of cellular process
GO:0010604	0.917	positive regulation of macromolecule metabolic process
GO:0009987	0.912	cellular process
GO:0031325	0.899	positive regulation of cellular metabolic process
GO:0051173	0.898	positive regulation of nitrogen compound metabolic process
GO:0009891	0.873	positive regulation of biosynthetic process
GO:0045935	0.871	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.852	positive regulation of DNA-templated transcription
GO:0006357	0.774	regulation of transcription by RNA polymerase II
GO:0009892	0.719	negative regulation of metabolic process
GO:0048523	0.584	negative regulation of cellular process
GO:0048513	0.543	animal organ development
GO:0001501	0.540	skeletal system development
GO:0031324	0.408	negative regulation of cellular metabolic process
GO:0045944	0.406	positive regulation of transcription by RNA polymerase II
GO:0031327	0.371	negative regulation of cellular biosynthetic process
GO:0050896	0.325	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.963	cytoplasm
GO:0012505	0.942	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]