StarFunc result for job id Q15714

User Input

>input (1073 residues)
MHQPPESTAAAAAAADISARKMAHPAMFPRRGSGSGSASALNAAGTGVGSNATSSEDFPP
PSLLQPPPPAASSTSGPQPPPPQSLNLLSQAQLQAQPLAPGGTQMKKKSGFQITSVTPAQ
ISASISSNNSIAEDTESYDDLDESHTEDLSSSEILDVSLSRATDLGEPERSSSEETLNNF
QEAETPGAVSPNQPHLPQPHLPHLPQQNVVINGNAHPHHLHHHHQIHHGHHLQHGHHHPS
HVAVASASITGGPPSSPVSRKLSTTGSSDSITPVAPTSAVSSSGSPASVMTNMRAPSTTG
GIGINSVTGTSTVNNVNITAVGSFNPNVTSSMLGNVNISTSNIPSAAGVSVGPGVTSGVN
VNILSGMGNGTISSSAAVSSVPNAAAGMTGGSVSSQQQQPTVNTSRFRVVKLDSSSEPFK
KGRWTCTEFYEKENAVPATEGVLINKVVETVKQNPIEVTSERESTSGSSVSSSVSTLSHY
TESVGSGEMGAPTVVVQQQQQQQQQQQQQPALQGVTLQQMDFGSTGPQSIPAVSIPQSIS
QSQISQVQLQSQELSYQQKQGLQPVPLQATMSAATGIQPSPVNVVGVTSALGQQPSISSL
AQPQLPYSQAAPPVQTPLPGAPPPQQLQYGQQQPMVSTQMAPGHVKSVTQNPASEYVQQQ
PILQTAMSSGQPSSAGVGAGTTVIPVAQPQGIQLPVQPTAVPAQPAGASVQPVGQAPAAV
SAVPTGSQIANIGQQANIPTAVQQPSTQVPPSVIQQGAPPSSQVVPPAQTGIIHQGVQTS
APSLPQQLVIASQSSLLTVPPQPQGVEPVAQGIVSQQLPAVSSLPSASSISVTSQVSSTG
PSGMPSAPTNLVPPQNIAQTPATQNGNLVQSVSQPPLIATNTNLPLAQQIPLSSTQFSAQ
SLAQAIGSQIEDARRAAEPSLVGLPQTISGDSGGMSAVSDGSSSSLAASASLFPLKVLPL
TTPLVDGEDESSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQL
EQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P62500	0.210	0.210	0.000	1077	0.862	0.859	P62500.pdb.gz	T22D1_MOUSE TSC22 domain family protein 1 OS=Mus musculus OX=10090 GN=Tsc22d1 PE=1 SV=2
2	AFDB:Q15714	0.999	0.999	0.000	1073	1.000	1.000	Q15714.pdb.gz	T22D1_HUMAN TSC22 domain family protein 1 OS=Homo sapiens OX=9606 GN=TSC22D1 PE=1 SV=3
3	AFDB:E9Q7M2	0.106	0.141	1.526E-19	769	0.279	0.389	E9Q7M2.pdb.gz	T22D2_MOUSE TSC22 domain family protein 2 OS=Mus musculus OX=10090 GN=Tsc22d2 PE=1 SV=1
4	AFDB:A0A0G2JFZ4	0.078	0.105	4.145E-18	745	0.269	0.388	A0A0G2JFZ4.pdb.gz
5	AFDB:Q24523	0.102	0.084	4.901E-15	1331	0.250	0.201	Q24523.pdb.gz	BUN2_DROME Protein bunched, class 2/F/G isoform OS=Drosophila melanogaster OX=7227 GN=bun PE=2 SV=4
6	AFDB:Q9VA36	0.065	0.078	4.723E-3	882	0.116	0.141	Q9VA36.pdb.gz	Q9VA36_DROME CIN85 and CD2AP related, isoform C OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=2
7	AFDB:P29617	0.061	0.041	6.468E-3	1703	0.150	0.095	P29617.pdb.gz	PROS_DROME Homeobox protein prospero OS=Drosophila melanogaster OX=7227 GN=pros PE=1 SV=3
8	AFDB:Q5JR59	0.056	0.045	6.468E-3	1369	0.167	0.131	Q5JR59.pdb.gz	MTUS2_HUMAN Microtubule-associated tumor suppressor candidate 2 OS=Homo sapiens OX=9606 GN=MTUS2 PE=1 SV=3
9	AFDB:Q8NEY1	0.052	0.036	6.468E-3	1877	0.166	0.095	Q8NEY1.pdb.gz	NAV1_HUMAN Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2
10	AFDB:E9Q842	0.045	0.025	8.859E-3	2432	0.187	0.083	E9Q842.pdb.gz	E9Q842_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=1 SV=1
11	PDB:5lj5O	0.041	0.131	1.691	283	0.013	0.049	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
12	PDB:5wlcST	0.057	0.096	5.500	599	0.013	0.023	5wlcST.pdb.gz	The complete structure of the small-subunit processome.
13	PDB:6hivAg	0.035	0.114	5.950	259	0.012	0.050	6hivAg.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
14	PDB:6zqaUB	0.056	0.113	6.436	504	0.010	0.022	6zqaUB.pdb.gz	90 S pre-ribosome transformation into the primordial 40 S subunit.
15	PDB:6exnO	0.032	0.089	6.963	320	0.019	0.062	6exnO.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
16	PDB:7d4iRJ	0.049	0.067	9.535	738	0.021	0.030	7d4iRJ.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P62500	0.0	1372	1077	0.862	0.859	T22D1_MOUSE TSC22 domain family protein 1 OS=Mus musculus OX=10090 GN=Tsc22d1 PE=1 SV=2
2	Q15714	0.0	2060	1073	1.000	1.000	T22D1_HUMAN TSC22 domain family protein 1 OS=Homo sapiens OX=9606 GN=TSC22D1 PE=1 SV=3
3	P62501	7.00e-60	203	143	0.094	0.706	T22D1_RAT TSC22 domain family protein 1 OS=Rattus norvegicus OX=10116 GN=Tsc22d1 PE=2 SV=2
4	Q9EQZ1	9.50e-37	137	134	0.059	0.470	T22D3_RAT TSC22 domain family protein 3 OS=Rattus norvegicus OX=10116 GN=Tsc22d3 PE=1 SV=1
5	Q9Z2S7	1.33e-36	137	137	0.059	0.460	T22D3_MOUSE TSC22 domain family protein 3 OS=Mus musculus OX=10090 GN=Tsc22d3 PE=1 SV=2
6	Q99576	1.43e-35	134	134	0.059	0.470	T22D3_HUMAN TSC22 domain family protein 3 OS=Homo sapiens OX=9606 GN=TSC22D3 PE=1 SV=2
7	Q6NTI0	1.55e-34	131	143	0.058	0.434	Q6NTI0_DANRE TSC22 domain family protein 3 isoform 1 OS=Danio rerio OX=7955 GN=zgc:64189 PE=2 SV=1
8	Q9CVK3	9.66e-34	128	124	0.061	0.524	Q9CVK3_MOUSE TSC22 domain family protein 2 OS=Mus musculus OX=10090 GN=Tsc22d2 PE=2 SV=2
9	Q148S0	3.35e-33	136	454	0.087	0.205	Q148S0_MOUSE Tsc22d2 protein OS=Mus musculus OX=10090 GN=Tsc22d2 PE=2 SV=1
10	Q9EQN3	1.07e-25	112	387	0.047	0.129	T22D4_MOUSE TSC22 domain family protein 4 OS=Mus musculus OX=10090 GN=Tsc22d4 PE=1 SV=2
11	Q9Y3Q8	1.18e-25	112	395	0.048	0.129	T22D4_HUMAN TSC22 domain family protein 4 OS=Homo sapiens OX=9606 GN=TSC22D4 PE=1 SV=2
12	Q3U1C5	2.20e-21	91.7	87	0.043	0.529	Q3U1C5_MOUSE TSC22 domain family protein 2 OS=Mus musculus OX=10090 GN=Tsc22d2 PE=2 SV=1
13	Q24522	1.70e-20	93.6	219	0.050	0.247	BUN1_DROME Protein bunched, class 1/class 3/D/E isoforms OS=Drosophila melanogaster OX=7227 GN=bun PE=2 SV=2
14	E9Q7M2	3.46e-20	99.0	769	0.056	0.078	T22D2_MOUSE TSC22 domain family protein 2 OS=Mus musculus OX=10090 GN=Tsc22d2 PE=1 SV=1
15	Q24523	3.21e-19	96.3	1331	0.051	0.041	BUN2_DROME Protein bunched, class 2/F/G isoform OS=Drosophila melanogaster OX=7227 GN=bun PE=2 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14645 Chibby	6.5e+02	11.7	Chibby family
2	PF01486 K-box	33	16.1	K-box region
3	PF11365 SOGA	1.5e+02	14.8	Protein SOGA
4	PF01166 TSC22	5.8e-25	98.6	TSC-22/dip/bun family
5	PF06156 YabA	3.2	19.8	Initiation control protein YabA
6	PF06005 ZapB	4.1e+02	12.8	Cell division protein ZapB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000397435

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300181	0.800	TSC22 domain family protein 4
2	9606.ENSP00000328551	0.789	Ras-related protein Rab-28
3	9606.ENSP00000352420	0.756	Low-density lipoprotein receptor class A domain-containing protein 4
4	9606.ENSP00000361458	0.717	TSC22 domain family protein 3
5	9606.ENSP00000233557	0.643	Nuclear receptor-binding protein
6	9606.ENSP00000263726	0.643	LIM/homeobox protein Lhx4
7	9606.ENSP00000288466	0.605	Zinc finger protein 618
8	9606.ENSP00000360811	0.574	LIM/homeobox protein Lhx3
9	9606.ENSP00000257915	0.527	Alpha-globin transcription factor CP2
10	9606.ENSP00000338927	0.507	Zinc finger protein 385A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0071704	0.986	organic substance metabolic process
GO:0044238	0.985	primary metabolic process
GO:0044237	0.984	cellular metabolic process
GO:0006807	0.982	nitrogen compound metabolic process
GO:0043170	0.979	macromolecule metabolic process
GO:0006351	0.973	DNA-templated transcription
GO:0006366	0.920	transcription by RNA polymerase II
GO:0050896	0.328	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0043233	0.543	organelle lumen
GO:0070013	0.530	intracellular organelle lumen
GO:0005829	0.425	cytosol
GO:0031981	0.380	nuclear lumen
GO:0005654	0.332	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]