StarFunc result for job id Q15735

User Input

>input (1006 residues)
MEGQSSRGSRRPGTRAGLGSLPMPQGVAQTGAPSKVDSSFQLPAKKNAALGPSEPRLALA
PVGPRAAMSASSEGPRLALASPRPILAPLCTPEGQKTATAHRSSSLAPTSVGQLVMSASA
GPKPPPATTGSVLAPTSLGLVMPASAGPRSPPVTLGPNLAPTSRDQKQEPPASVGPKPTL
AASGLSLALASEEQPPELPSTPSPVPSPVLSPTQEQALAPASTASGAASVGQTSARKRDA
PAPRPLPASEGHLQPPAQTSGPTGSPPCIQTSPDPRLSPSFRARPEALHSSPEDPVLPRP
PQTLPLDVGQGPSEPGTHSPGLLSPTFRPGAPSGQTVPPPLPKPPRSPSRSPSHSPNRSP
CVPPAPDMALPRLGTQSTGPGRCLSPNLQAQEAPAPVTTSSSTSTLSSSPWSAQPTWKSD
PGFRITVVTWNVGTAMPPDDVTSLLHLGGGDDSDGADMIAIGLQEVNSMLNKRLKDALFT
DQWSELFMDALGPFNFVLVSSVRMQGVILLLFAKYYHLPFLRDVQTDCTRTGLGGYWGNK
GGVSVRLAAFGHMLCFLNCHLPAHMDKAEQRKDNFQTILSLQQFQGPGAQGILDHDLVFW
FGDLNFRIESYDLHFVKFAIDSDQLHQLWEKDQLNMAKNTWPILKGFQEGPLNFAPTFKF
DVGTNKYDTSAKKRKPAWTDRILWKVKAPGGGPSPSGRKSHRLQVTQHSYRSHMEYTVSD
HKPVAAQFLLQFAFRDDMPLVRLEVADEWVRPEQAVVRYRMETVFARSSWDWIGLYRVGF
RHCKDYVAYVWAKHEDVDGNTYQVTFSEESLPKGHGDFILGYYSHNHSILIGITEPFQIS
LPSSELASSSTDSSGTSSEGEDDSTLELLAPKSRSPSPGKSKRHRSRSPGLARFPGLALR
PSSRERRGASRSPSPQSRRLSRVAPDRSSNGSSRGSSEEGPSGLPGPWAFPPAVPRSLGL
LPALRLETVDPGGGGSWGPDREALAPNSLSPSPQGHRGLEEGGLGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15735	1.000	1.000	0.000	1006	1.000	1.000	Q15735.pdb.gz	PI5PA_HUMAN Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Homo sapiens OX=9606 GN=INPP5J PE=1 SV=3
2	AFDB:A0A0R4IWP4	0.395	0.815	1.662E-60	476	0.208	0.439	A0A0R4IWP4.pdb.gz
3	AFDB:Q9BT40	0.407	0.895	2.688E-57	448	0.197	0.442	Q9BT40.pdb.gz	INP5K_HUMAN Inositol polyphosphate 5-phosphatase K OS=Homo sapiens OX=9606 GN=INPP5K PE=1 SV=3
4	AFDB:O14306	0.278	0.238	4.616E-23	1191	0.183	0.154	O14306.pdb.gz	YE8A_SCHPO Probable inositol polyphosphate 5-phosphatase C9G1.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC9G1.10c PE=1 SV=2
5	PDB:2imqX	0.250	0.835	5.937E-22	280	0.072	0.257	2imqX.pdb.gz	Heme-assisted S-nitrosation of a proximal thiolate in a nitric oxide transport protein
6	AFDB:Q62910	0.281	0.183	2.458E-19	1574	0.162	0.104	Q62910.pdb.gz	SYNJ1_RAT Synaptojanin-1 OS=Rattus norvegicus OX=10116 GN=Synj1 PE=1 SV=3
7	PDB:4f1iA	0.164	0.423	6.030E-10	328	0.057	0.174	4f1iA.pdb.gz
8	PDB:2j63A	0.168	0.416	8.995E-8	333	0.042	0.126	2j63A.pdb.gz
9	PDB:6o1kA	0.181	0.552	1.632E-7	262	0.042	0.160	6o1kA.pdb.gz	Architectural principles for Hfq/Crc-mediated regulation of gene expression
10	PDB:1akoA	0.179	0.536	1.732E-7	268	0.039	0.146	1akoA.pdb.gz
11	PDB:7cd5A	0.168	0.492	4.234E-7	278	0.045	0.162	7cd5A.pdb.gz	APE1 distinguishes DNA substrates in exonucleolytic cleavage by induced space-filling.
12	PDB:7ax1A	0.172	0.301	6.426E-7	518	0.053	0.102	7ax1A.pdb.gz	Crystal structure and functional properties of the human CCR4-CAF1 deadenylase complex.
13	AFDB:A0A1D5PNG2	0.096	0.107	1.175E-6	890	0.127	0.144	A0A1D5PNG2.pdb.gz
14	PDB:4awnA	0.178	0.526	3.839E-6	260	0.046	0.177	4awnA.pdb.gz	The Structure of Human DNase I Bound to Magnesium and Phosphate Ions Points to a Catalytic Mechanism Common to Members of the DNase I-Like Superfamily.
15	AFDB:W5U9R6	0.096	0.107	5.533E-6	879	0.130	0.149	W5U9R6.pdb.gz	W5U9R6_ICTPU Nuclear factor of activated T-cells, cytoplasmic 1 OS=Ictalurus punctatus OX=7998 GN=NFATC1 PE=2 SV=1
16	AFDB:O95644	0.104	0.109	9.458E-6	943	0.164	0.175	O95644.pdb.gz	NFAC1_HUMAN Nuclear factor of activated T-cells, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=NFATC1 PE=1 SV=3
17	PDB:2a3zB	0.167	0.496	1.191E-5	260	0.048	0.185	2a3zB.pdb.gz	Actin-bound structures of Wiskott-Aldrich syndrome protein (WASP)-homology domain 2 and the implications for filament assembly
18	PDB:7kiuA	0.166	0.504	1.191E-5	263	0.046	0.175	7kiuA.pdb.gz	Structural features of Dnase1L3 responsible for serum antigen clearance.
19	AFDB:D3ZE20	0.094	0.112	7.612E-5	827	0.150	0.183	D3ZE20.pdb.gz	D3ZE20_RAT Nuclear factor of activated T-cells 1 OS=Rattus norvegicus OX=10116 GN=Nfatc1 PE=4 SV=4
20	AFDB:A0A0G2JTY4	0.093	0.088	4.827E-4	1076	0.153	0.143	A0A0G2JTY4.pdb.gz	A0A0G2JTY4_RAT Nuclear factor of activated T-cells 3 OS=Rattus norvegicus OX=10116 GN=Nfatc3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P59644	0.0	1413	1003	0.820	0.823	PI5PA_MOUSE Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Mus musculus OX=10090 GN=Inpp5j PE=1 SV=2
2	Q15735	0.0	2010	1006	1.000	1.000	PI5PA_HUMAN Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Homo sapiens OX=9606 GN=INPP5J PE=1 SV=3
3	Q9JMC1	0.0	1467	1001	0.837	0.841	PI5PA_RAT Phosphatidylinositol 4,5-bisphosphate 5-phosphatase A OS=Rattus norvegicus OX=10116 GN=Inpp5j PE=1 SV=1
4	A4QP54	3.93e-138	424	456	0.206	0.454	A4QP54_DANRE Zgc:162883 protein OS=Danio rerio OX=7955 GN=inpp5ka PE=2 SV=1
5	A0A2R8QKI3	2.49e-131	409	526	0.201	0.384	A0A2R8QKI3_DANRE Inositol polyphosphate-5-phosphatase Kb OS=Danio rerio OX=7955 GN=inpp5kb PE=3 SV=1
6	Q8C5L6	3.08e-126	393	468	0.199	0.427	INP5K_MOUSE Inositol polyphosphate 5-phosphatase K OS=Mus musculus OX=10090 GN=Inpp5k PE=1 SV=2
7	Q9BT40	2.24e-121	380	448	0.195	0.438	INP5K_HUMAN Inositol polyphosphate 5-phosphatase K OS=Homo sapiens OX=9606 GN=INPP5K PE=1 SV=3
8	E7ESY0	1.76e-50	193	748	0.109	0.147	E7ESY0_HUMAN phosphoinositide 5-phosphatase OS=Homo sapiens OX=9606 GN=INPP5B PE=1 SV=2
9	P32019	6.27e-50	194	993	0.108	0.110	I5P2_HUMAN Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Homo sapiens OX=9606 GN=INPP5B PE=1 SV=4
10	Q6NVF0	2.46e-49	191	900	0.111	0.124	OCRL_MOUSE Inositol polyphosphate 5-phosphatase OCRL OS=Mus musculus OX=10090 GN=Ocrl PE=1 SV=1
11	Q9D2G5	4.86e-49	192	1434	0.117	0.082	SYNJ2_MOUSE Synaptojanin-2 OS=Mus musculus OX=10090 GN=Synj2 PE=1 SV=2
12	O15056	6.74e-49	192	1496	0.112	0.076	SYNJ2_HUMAN Synaptojanin-2 OS=Homo sapiens OX=9606 GN=SYNJ2 PE=1 SV=3
13	Q8K337	8.17e-49	190	993	0.116	0.118	I5P2_MOUSE Type II inositol 1,4,5-trisphosphate 5-phosphatase OS=Mus musculus OX=10090 GN=Inpp5b PE=1 SV=1
14	O55207	3.03e-48	190	1496	0.123	0.083	SYNJ2_RAT Synaptojanin-2 OS=Rattus norvegicus OX=10116 GN=Synj2 PE=1 SV=2
15	D3ZGS3	2.05e-47	186	902	0.106	0.119	OCRL_RAT Inositol polyphosphate 5-phosphatase OCRL OS=Rattus norvegicus OX=10116 GN=Ocrl PE=1 SV=1
16	A0A0R4IPY6	5.25e-47	184	961	0.134	0.140	A0A0R4IPY6_DANRE phosphoinositide 5-phosphatase OS=Danio rerio OX=7955 GN=wu:fi09g03 PE=1 SV=1
17	F1QIY4	7.57e-47	184	953	0.134	0.142	F1QIY4_DANRE phosphoinositide 5-phosphatase OS=Danio rerio OX=7955 GN=wu:fi09g03 PE=1 SV=2
18	Q01968	4.13e-46	181	901	0.107	0.120	OCRL_HUMAN Inositol polyphosphate 5-phosphatase OCRL OS=Homo sapiens OX=9606 GN=OCRL PE=1 SV=3
19	Q8I7P3	7.49e-45	176	787	0.114	0.146	Q8I7P3_DICDI Inositol 5-phosphatase 4 OS=Dictyostelium discoideum OX=44689 GN=Dd5P4 PE=3 SV=1
20	G5ECL2	1.48e-44	177	1119	0.115	0.104	SYNJ_CAEEL Synaptojanin OS=Caenorhabditis elegans OX=6239 GN=unc-26 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03372 Exo_endo_phos	1.4e-06	39.7	Endonuclease/Exonuclease/phosphatase family
2	PF17751 SKICH	8.4e-22	89.0	SKICH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333262

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357583	0.948	Type I inositol 1,4,5-trisphosphate 5-phosphatase
2	9606.ENSP00000373713	0.943	Phosphatidylinositide phosphatase SAC1
3	9606.ENSP00000267615	0.938	Inositol-tetrakisphosphate 1-kinase
4	9606.ENSP00000376142	0.935	Inositol polyphosphate-1-phosphatase
5	9606.ENSP00000411152	0.934	Inositol-trisphosphate 3-kinase B
6	9606.ENSP00000361021	0.930	Phosphatase and tensin homolog
7	9606.ENSP00000363046	0.930	Inositol polyphosphate multikinase
8	9606.ENSP00000383089	0.924	Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2
9	9606.ENSP00000260386	0.917	Inositol-trisphosphate 3-kinase A
10	9606.ENSP00000361064	0.911	Multiple inositol polyphosphate phosphatase 1
11	9606.ENSP00000263370	0.906	Inositol-trisphosphate 3-kinase C
12	9606.ENSP00000413937	0.807	Inositol polyphosphate 5-phosphatase K
13	9606.ENSP00000360431	0.776	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1
14	9606.ENSP00000367747	0.710	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2
15	9606.ENSP00000260402	0.706	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
16	9606.ENSP00000345988	0.704	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1
17	9606.ENSP00000367762	0.681	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
18	9606.ENSP00000388631	0.680	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4
19	9606.ENSP00000430344	0.680	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1
20	9606.ENSP00000479636	0.680	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046030	1.000	inositol trisphosphate phosphatase activity
GO:0034595	1.000	phosphatidylinositol phosphate 5-phosphatase activity
GO:0034594	1.000	phosphatidylinositol trisphosphate phosphatase activity
GO:0005515	0.999	protein binding
GO:0034485	0.976	phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase activity
GO:0052658	0.648	inositol-1,4,5-trisphosphate 5-phosphatase activity
GO:0034593	0.307	phosphatidylinositol bisphosphate phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0071704	0.985	organic substance metabolic process
GO:0044237	0.984	cellular metabolic process
GO:0044238	0.976	primary metabolic process
GO:0065007	0.969	biological regulation
GO:0050794	0.959	regulation of cellular process
GO:0046488	0.936	phosphatidylinositol metabolic process
GO:0006661	0.926	phosphatidylinositol biosynthetic process
GO:0006066	0.888	alcohol metabolic process
GO:0043647	0.850	inositol phosphate metabolic process
GO:0050896	0.403	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0120025	0.999	plasma membrane bounded cell projection
GO:0005737	0.999	cytoplasm
GO:0016020	0.998	membrane
GO:0005829	0.993	cytosol
GO:0005886	0.991	plasma membrane
GO:0043226	0.958	organelle
GO:0031252	0.927	cell leading edge
GO:0043227	0.917	membrane-bounded organelle
GO:0043229	0.904	intracellular organelle
GO:0001726	0.882	ruffle
GO:0043231	0.791	intracellular membrane-bounded organelle
GO:0043005	0.685	neuron projection
GO:0012505	0.509	endomembrane system
GO:0070013	0.347	intracellular organelle lumen
GO:0031981	0.340	nuclear lumen
GO:0098590	0.315	plasma membrane region
GO:0005654	0.307	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.3.-	1.000	Phosphoric monoester hydrolases.
RHEA:25528	0.976	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + H2O = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4-bisphosphate) + phosphate
RHEA:19797	0.648	1D-myo-inositol 1,4,5-trisphosphate + H2O = 1D-myo-inositol 1,4-bisphosphate + phosphate
EC:3.1.3.56	0.648	inositol-polyphosphate 5-phosphatase.

[back to server]