StarFunc result for job id Q15742

User Input

>input (525 residues)
MHRAPSPTAEQPPGGGDSARRTLQPRLKPSARAMALPRTLGELQLYRVLQRANLLSYYET
FIQQGGDDVQQLCEAGEEEFLEIMALVGMATKPLHVRRLQKALREWATNPGLFSQPVPAV
PVSSIPLFKISETAGTRKGSMSNGHGSPGEKAGSARSFSPKSPLELGEKLSPLPGGPGAG
DPRIWPGRSTPESDVGAGGEEEAGSPPFSPPAGGGVPEGTGAGGLAAGGTGGGPDRLEPE
MVRMVVESVERIFRSFPRGDAGEVTSLLKLNKKLARSVGHIFEMDDNDSQKEEEIRKYSI
IYGRFDSKRREGKQLSLHELTINEAAAQFCMRDNTLLLRRVELFSLSRQVARESTYLSSL
KGSRLHPEELGGPPLKKLKQEVGEQSHPEIQQPPPGPESYVPPYRPSLEEDSASLSGESL
DGHLQAVGSCPRLTPPPADLPLALPAHGLWSRHILQQTLMDEGLRLARLVSHDRVGRLSP
CVPAKPPLAEFEEGLLDRCPAPGPHPALVEGRRSSVKVEAEASRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15742	0.999	0.999	1.427E-61	525	1.000	1.000	Q15742.pdb.gz	NAB2_HUMAN NGFI-A-binding protein 2 OS=Homo sapiens OX=9606 GN=NAB2 PE=1 SV=1
2	AFDB:D4A4F4	0.397	0.397	3.291E-56	525	0.966	0.966	D4A4F4.pdb.gz	D4A4F4_RAT Ngfi-A binding protein 2 OS=Rattus norvegicus OX=10116 GN=Nab2 PE=1 SV=2
3	AFDB:Q13506	0.285	0.305	1.265E-24	487	0.404	0.435	Q13506.pdb.gz	NAB1_HUMAN NGFI-A-binding protein 1 OS=Homo sapiens OX=9606 GN=NAB1 PE=1 SV=2
4	AFDB:Q59E55	0.227	0.195	6.391E-18	625	0.305	0.256	Q59E55.pdb.gz	NAB_DROME NGFI-A-binding protein homolog OS=Drosophila melanogaster OX=7227 GN=nab PE=1 SV=3
5	AFDB:Q9Y808	0.092	0.067	4.095E-3	1063	0.160	0.079	Q9Y808.pdb.gz	MED15_SCHPO Mediator of RNA polymerase II transcription subunit 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=med15 PE=1 SV=3
6	AFDB:O14647	0.079	0.032	2.298E-2	1828	0.145	0.042	O14647.pdb.gz	CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens OX=9606 GN=CHD2 PE=1 SV=2
7	AFDB:Q6ZT98	0.079	0.054	2.884E-2	887	0.118	0.070	Q6ZT98.pdb.gz	TTLL7_HUMAN Tubulin polyglutamylase TTLL7 OS=Homo sapiens OX=9606 GN=TTLL7 PE=1 SV=2
8	AFDB:O80910	0.097	0.083	4.340E-2	671	0.160	0.125	O80910.pdb.gz	TOL6_ARATH TOM1-like protein 6 OS=Arabidopsis thaliana OX=3702 GN=TOL6 PE=1 SV=1
9	AFDB:A8T6P4	0.089	0.061	5.445E-2	838	0.152	0.095	A8T6P4.pdb.gz	MYRIP_DANRE Rab effector MyRIP OS=Danio rerio OX=7955 GN=myrip PE=1 SV=1
10	AFDB:Q9C5H4	0.082	0.072	6.240E-2	690	0.130	0.099	Q9C5H4.pdb.gz	MTV1_ARATH Protein MODIFIED TRANSPORT TO THE VACUOLE 1 OS=Arabidopsis thaliana OX=3702 GN=MTV1 PE=1 SV=1
11	PDB:1yo7A	0.057	0.167	3.560	120	0.038	0.167	1yo7A.pdb.gz	Structure of the ColE1 rop protein at 1.7 A resolution
12	PDB:3duhC	0.085	0.250	4.674	137	0.040	0.153	3duhC.pdb.gz
13	PDB:7mq8SB	0.082	0.094	4.674	440	0.040	0.048	7mq8SB.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:4da5A	0.082	0.109	4.891	352	0.032	0.048	4da5A.pdb.gz	Kinetic and mechanistic characterisation of Choline Kinase-alpha.
15	PDB:1keyB	0.061	0.126	5.356	221	0.040	0.095	1keyB.pdb.gz
16	PDB:7z37DP1	0.075	0.111	5.865	273	0.067	0.128	7z37DP1.pdb.gz	Structure of the RAF1-HSP90-CDC37 complex reveals the basis of RAF1 regulation.
17	PDB:6lqsBE	0.085	0.062	6.137	823	0.036	0.023	6lqsBE.pdb.gz	Cryo-EM structure of 90 S small ribosomal subunit precursors in transition states.
18	PDB:7zs9M	0.065	0.094	6.137	310	0.027	0.045	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
19	PDB:5ew5A	0.070	0.074	6.422	490	0.017	0.018	5ew5A.pdb.gz
20	PDB:6o6pA	0.082	0.173	6.721	188	0.030	0.085	6o6pA.pdb.gz	Mycobacterium tuberculosis FasR senses long fatty acyl-CoA through a tunnel and a hydrophobic transmission spine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A4F4	0.0	758	461	0.785	0.894	D4A4F4_RAT Ngfi-A binding protein 2 OS=Rattus norvegicus OX=10116 GN=Nab2 PE=1 SV=2
2	Q15742	0.0	1045	525	1.000	1.000	NAB2_HUMAN NGFI-A-binding protein 2 OS=Homo sapiens OX=9606 GN=NAB2 PE=1 SV=1
3	Q61127	0.0	971	525	0.956	0.956	NAB2_MOUSE NGFI-A-binding protein 2 OS=Mus musculus OX=10090 GN=Nab2 PE=1 SV=2
4	Q13506	8.58e-109	335	487	0.341	0.368	NAB1_HUMAN NGFI-A-binding protein 1 OS=Homo sapiens OX=9606 GN=NAB1 PE=1 SV=2
5	Q61122	2.27e-107	331	486	0.354	0.383	NAB1_MOUSE NGFI-A-binding protein 1 OS=Mus musculus OX=10090 GN=Nab1 PE=1 SV=2
6	Q59E55	2.34e-54	195	625	0.246	0.206	NAB_DROME NGFI-A-binding protein homolog OS=Drosophila melanogaster OX=7227 GN=nab PE=1 SV=3
7	Q22002	1.90e-21	100	582	0.088	0.079	MAB10_CAEEL NAB transcription cofactor mab-10 OS=Caenorhabditis elegans OX=6239 GN=mab-10 PE=1 SV=2
8	Q3V1H9	0.042	37.7	173	0.074	0.225	SAMD5_MOUSE Sterile alpha motif domain-containing protein 5 OS=Mus musculus OX=10090 GN=Samd5 PE=1 SV=1
9	O97267	0.090	38.1	2114	0.055	0.014	O97267_PLAF7 Circumsporozoite- and TRAP-related protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0315200 PE=4 SV=1
10	G5ED39	0.85	35.0	1262	0.032	0.013	SEP1_CAEEL Separin homolog sep-1 OS=Caenorhabditis elegans OX=6239 GN=sep-1 PE=1 SV=1
11	P41698	1.8	33.9	603	0.055	0.048	BUD8_YEAST Bud site selection protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BUD8 PE=1 SV=2
12	Q9BKJ9	3.4	33.1	755	0.034	0.024	LMPB_DICDI Lysosome membrane protein 2-B OS=Dictyostelium discoideum OX=44689 GN=lmpB PE=1 SV=1
13	Q9UL42	5.4	32.0	364	0.053	0.077	PNMA2_HUMAN Paraneoplastic antigen Ma2 OS=Homo sapiens OX=9606 GN=PNMA2 PE=1 SV=2
14	Q9CZ16	9.5	31.2	297	0.040	0.071	T178A_MOUSE Transmembrane protein 178A OS=Mus musculus OX=10090 GN=Tmem178a PE=1 SV=3
15	Q9VXF9	9.7	31.2	458	0.034	0.039	Q9VXF9_DROME AT13091p OS=Drosophila melanogaster OX=7227 GN=rngo PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04904 NCD1	3e-40	147.4	NAB conserved region 1 (NCD1)
2	PF04905 NCD2	1.2e-48	175.7	NAB conserved region 2 (NCD2)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000300131

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349508	0.989	Chromodomain-helicase-DNA-binding protein 4
2	9606.ENSP00000239938	0.981	Early growth response protein 1
3	9606.ENSP00000242480	0.975	E3 SUMO-protein ligase EGR2
4	9606.ENSP00000318057	0.966	Early growth response protein 3
5	9606.ENSP00000234091	0.918	DNA-binding protein inhibitor ID-2
6	9606.ENSP00000367972	0.908	DNA-binding protein inhibitor ID-4
7	9606.ENSP00000299759	0.906	GTP-binding protein RAD
8	9606.ENSP00000318486	0.900	Cyclin-dependent kinase 5 activator 1
9	9606.ENSP00000369716	0.871	Chromodomain-helicase-DNA-binding protein 3
10	9606.ENSP00000445626	0.748	Early growth response protein 4
11	9606.ENSP00000300134	0.744	Signal transducer and activator of transcription 6
12	9606.ENSP00000387699	0.707	Cyclic AMP-responsive element-binding protein 1
13	9606.ENSP00000380093	0.703	Transcription factor SOX-10
14	9606.ENSP00000356405	0.701	Parafibromin
15	9606.ENSP00000265354	0.698	Serum response factor
16	9606.ENSP00000419782	0.677	Cyclin-dependent-like kinase 5
17	9606.ENSP00000436679	0.651	Nuclear RNA export factor 1
18	9606.ENSP00000480091	0.651	Nicotinamide riboside kinase 2
19	9606.ENSP00000304250	0.650	Cyclin-dependent kinase 5 activator 2
20	9606.ENSP00000251038	0.643	Zinc finger CCCH domain-containing protein 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0003714	1.000	transcription corepressor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0009889	0.988	regulation of biosynthetic process
GO:0019219	0.988	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.986	regulation of gene expression
GO:0031326	0.968	regulation of cellular biosynthetic process
GO:0010556	0.965	regulation of macromolecule biosynthetic process
GO:0051252	0.965	regulation of RNA metabolic process
GO:0006355	0.938	regulation of DNA-templated transcription
GO:0009987	0.923	cellular process
GO:0045892	0.717	negative regulation of DNA-templated transcription
GO:0048518	0.629	positive regulation of biological process
GO:0032502	0.529	developmental process
GO:0048856	0.470	anatomical structure development
GO:0009893	0.466	positive regulation of metabolic process
GO:0006359	0.464	regulation of transcription by RNA polymerase III
GO:0032501	0.448	multicellular organismal process
GO:0048522	0.441	positive regulation of cellular process
GO:0010604	0.412	positive regulation of macromolecule metabolic process
GO:0007275	0.397	multicellular organism development
GO:0051173	0.379	positive regulation of nitrogen compound metabolic process
GO:0031325	0.366	positive regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0005737	0.371	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]