StarFunc result for job id Q15744

User Input

>input (281 residues)
MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAV
KPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAV
KEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPC
SPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYM
AENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P56261	0.511	0.511	5.056E-36	281	0.936	0.936	P56261.pdb.gz	CEBPE_RAT CCAAT/enhancer-binding protein epsilon OS=Rattus norvegicus OX=10116 GN=Cebpe PE=1 SV=2
2	AFDB:E5Q8C6	0.275	0.226	3.090E-8	346	0.342	0.277	E5Q8C6.pdb.gz	E5Q8C6_PIG CCAAT/enhancer-binding protein OS=Sus scrofa OX=9823 GN=CEBPB PE=2 SV=1
3	AFDB:A5X2W0	0.301	0.281	4.365E-8	304	0.327	0.303	A5X2W0.pdb.gz	A5X2W0_ONCMY CCAAT/enhancer-binding protein OS=Oncorhynchus mykiss OX=8022 GN=cebpd PE=2 SV=1
4	AFDB:P18848	0.230	0.192	2.194E-2	351	0.203	0.162	P18848.pdb.gz	ATF4_HUMAN Cyclic AMP-dependent transcription factor ATF-4 OS=Homo sapiens OX=9606 GN=ATF4 PE=1 SV=3
5	AFDB:Q4H3V8	0.181	0.158	2.519E-2	340	0.210	0.174	Q4H3V8.pdb.gz	Q4H3V8_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-ATF4/5 PE=1 SV=1
6	AFDB:F4HRC9	0.162	0.115	5.773E-2	427	0.196	0.129	F4HRC9.pdb.gz	F4HRC9_ARATH Abscisic acid responsive elements-binding factor 2 OS=Arabidopsis thaliana OX=3702 GN=ABF2 PE=1 SV=1
7	AFDB:Q501B2	0.217	0.153	8.155E-2	409	0.199	0.137	Q501B2.pdb.gz	BZP16_ARATH bZIP transcription factor 16 OS=Arabidopsis thaliana OX=3702 GN=BZIP16 PE=1 SV=1
8	AFDB:Q02724	0.098	0.055	1.003E-1	621	0.171	0.077	Q02724.pdb.gz	ULP1_YEAST Ubiquitin-like-specific protease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ULP1 PE=1 SV=1
9	AFDB:Q91VW5	0.173	0.025	1.519E-1	2238	0.142	0.018	Q91VW5.pdb.gz	GOGA4_MOUSE Golgin subfamily A member 4 OS=Mus musculus OX=10090 GN=Golga4 PE=1 SV=2
10	AFDB:P42774	0.224	0.202	2.145E-1	315	0.203	0.181	P42774.pdb.gz	GBF1_ARATH G-box-binding factor 1 OS=Arabidopsis thaliana OX=3702 GN=GBF1 PE=1 SV=2
11	PDB:5wlcST	0.195	0.098	4.054	599	0.082	0.038	5wlcST.pdb.gz	The complete structure of the small-subunit processome.
12	PDB:7mq9SI	0.176	0.072	4.988	844	0.093	0.031	7mq9SI.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7ajtCL	0.145	0.066	5.345	781	0.089	0.032	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
14	PDB:7wtxt	0.075	0.157	5.727	132	0.100	0.212	7wtxt.pdb.gz	The nucleoplasmic phase of pre-40S formation prior to nuclear export.
15	PDB:7w59R	0.101	0.101	6.576	280	0.117	0.118	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
16	PDB:7d5sRN	0.205	0.102	7.046	607	0.082	0.038	7d5sRN.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
17	PDB:7d63RJ	0.144	0.064	7.046	796	0.089	0.031	7d63RJ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state C)
18	PDB:7ajuCL	0.150	0.056	8.090	808	0.075	0.026	7ajuCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
19	PDB:3axjB	0.077	0.090	9.289	240	0.018	0.021	3axjB.pdb.gz
20	PDB:6hivAg	0.062	0.066	9.289	259	0.032	0.035	6hivAg.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P56261	0.0	522	281	0.936	0.936	CEBPE_RAT CCAAT/enhancer-binding protein epsilon OS=Rattus norvegicus OX=10116 GN=Cebpe PE=1 SV=2
2	Q15744	0.0	566	281	1.000	1.000	CEBPE_HUMAN CCAAT/enhancer-binding protein epsilon OS=Homo sapiens OX=9606 GN=CEBPE PE=1 SV=2
3	Q6PZD9	0.0	521	281	0.932	0.932	CEBPE_MOUSE CCAAT/enhancer-binding protein epsilon OS=Mus musculus OX=10090 GN=Cebpe PE=1 SV=1
4	Q90582	1.40e-49	168	324	0.406	0.352	Q90582_CHICK CCAAT/enhancer-binding protein OS=Gallus gallus OX=9031 GN=cC PE=3 SV=1
5	Q8UVZ1	9.98e-47	160	288	0.423	0.413	Q8UVZ1_DANRE CCAAT/enhancer-binding protein OS=Danio rerio OX=7955 GN=c/ebpa PE=2 SV=1
6	A5X2V8	1.32e-41	147	320	0.377	0.331	A5X2V8_ONCMY CCAAT/enhancer-binding protein OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
7	F1RNW6	1.81e-39	142	354	0.416	0.331	F1RNW6_PIG CCAAT enhancer binding protein alpha OS=Sus scrofa OX=9823 GN=CEBPA PE=3 SV=1
8	P49715	2.78e-39	142	358	0.295	0.232	CEBPA_HUMAN CCAAT/enhancer-binding protein alpha OS=Homo sapiens OX=9606 GN=CEBPA PE=1 SV=3
9	P53566	1.52e-37	137	359	0.391	0.306	CEBPA_MOUSE CCAAT/enhancer-binding protein alpha OS=Mus musculus OX=10090 GN=Cebpa PE=1 SV=2
10	P05554	8.32e-36	133	358	0.402	0.316	CEBPA_RAT CCAAT/enhancer-binding protein alpha OS=Rattus norvegicus OX=10116 GN=Cebpa PE=1 SV=3
11	A5X2W0	5.74e-29	114	304	0.324	0.299	A5X2W0_ONCMY CCAAT/enhancer-binding protein OS=Oncorhynchus mykiss OX=8022 GN=cebpd PE=2 SV=1
12	Q05826	2.04e-28	112	328	0.210	0.180	CEBPB_CHICK CCAAT/enhancer-binding protein beta OS=Gallus gallus OX=9031 GN=CEBPB PE=1 SV=1
13	P49716	3.52e-28	110	269	0.388	0.405	CEBPD_HUMAN CCAAT/enhancer-binding protein delta OS=Homo sapiens OX=9606 GN=CEBPD PE=1 SV=2
14	E5Q8C6	5.39e-28	112	346	0.206	0.168	E5Q8C6_PIG CCAAT/enhancer-binding protein OS=Sus scrofa OX=9823 GN=CEBPB PE=2 SV=1
15	O97894	1.23e-27	103	69	0.181	0.739	O97894_PIG CCAAT/enhancer binding protein beta (Fragment) OS=Sus scrofa OX=9823 GN=C/EBP beta PE=2 SV=1
16	P28033	2.35e-26	106	296	0.196	0.186	CEBPB_MOUSE CCAAT/enhancer-binding protein beta OS=Mus musculus OX=10090 GN=Cebpb PE=1 SV=1
17	P21272	2.40e-26	106	297	0.196	0.185	CEBPB_RAT CCAAT/enhancer-binding protein beta OS=Rattus norvegicus OX=10116 GN=Cebpb PE=1 SV=1
18	Q7ZU07	8.22e-26	105	280	0.327	0.329	Q7ZU07_DANRE CCAAT/enhancer-binding protein OS=Danio rerio OX=7955 GN=wu:fe11e05 PE=2 SV=1
19	Q03484	2.40e-25	103	268	0.335	0.351	CEBPD_RAT CCAAT/enhancer-binding protein delta OS=Rattus norvegicus OX=10116 GN=Cebpd PE=2 SV=1
20	Q00322	2.36e-24	100	268	0.342	0.358	CEBPD_MOUSE CCAAT/enhancer-binding protein delta OS=Mus musculus OX=10090 GN=Cebpd PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	0.2	23.1	bZIP transcription factor
2	PF07716 bZIP_2	2.2e-11	55.0	Basic region leucine zipper
3	PF10792 DUF2605	5.1e+02	12.0	Protein of unknown function (DUF2605)
4	PF08702 Fib_alpha	5.8e+02	12.0	Fibrinogen alpha/beta chain family
5	PF02344 Myc-LZ	83	14.4	Myc leucine zipper domain
6	PF17076 SBE2	8.3e+02	9.6	SBE2, cell-wall formation
7	PF09728 Taxilin	5.5	17.7	Myosin-like coiled-coil protein
8	PF15136 UPF0449	1.7e+02	14.1	Uncharacterised protein family UPF0449

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000206513

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000227163	0.985	Transcription factor PU.1
2	9606.ENSP00000427514	0.957	CCAAT/enhancer-binding protein alpha
3	9606.ENSP00000254066	0.945	Retinoic acid receptor alpha
4	9606.ENSP00000263253	0.919	Histone acetyltransferase p300
5	9606.ENSP00000419692	0.912	Retinoic acid receptor RXR-alpha
6	9606.ENSP00000268058	0.908	Protein PML
7	9606.ENSP00000336790	0.787	Cyclic AMP-dependent transcription factor ATF-4
8	9606.ENSP00000365858	0.774	Erythroid transcription factor
9	9606.ENSP00000331614	0.744	DNA-binding protein Ikaros
10	9606.ENSP00000279873	0.743	AT-rich interactive domain-containing protein 5B
11	9606.ENSP00000216338	0.738	Granzyme H
12	9606.ENSP00000365757	0.681	Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha
13	9606.ENSP00000466090	0.666	Neutrophil elastase
14	9606.ENSP00000299736	0.649	Centromere protein V
15	9606.ENSP00000369286	0.639	Lymphocyte antigen 86
16	9606.ENSP00000339992	0.637	Transcriptional activator Myb
17	9606.ENSP00000310305	0.633	P2Y purinoceptor 2
18	9606.ENSP00000384053	0.623	Cytokine receptor common subunit beta
19	9606.ENSP00000359357	0.619	Zinc finger protein Gfi-1
20	9606.ENSP00000216336	0.618	Cathepsin G

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001216	0.999	DNA-binding transcription activator activity
GO:0000987	0.999	cis-regulatory region sequence-specific DNA binding
GO:0000977	0.999	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0044877	0.992	protein-containing complex binding
GO:0042802	0.936	identical protein binding
GO:0001228	0.925	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.898	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0008134	0.499	transcription factor binding
GO:0140297	0.481	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050789	0.995	regulation of biological process
GO:0010468	0.990	regulation of gene expression
GO:0050896	0.988	response to stimulus
GO:0009893	0.987	positive regulation of metabolic process
GO:0030097	0.981	hemopoiesis
GO:0010604	0.979	positive regulation of macromolecule metabolic process
GO:0048522	0.959	positive regulation of cellular process
GO:0080090	0.939	regulation of primary metabolic process
GO:0002521	0.932	leukocyte differentiation
GO:0009889	0.928	regulation of biosynthetic process
GO:0030099	0.919	myeloid cell differentiation
GO:0002573	0.897	myeloid leukocyte differentiation
GO:0031325	0.852	positive regulation of cellular metabolic process
GO:0019219	0.817	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.794	regulation of cellular biosynthetic process
GO:0010556	0.793	regulation of macromolecule biosynthetic process
GO:0051252	0.785	regulation of RNA metabolic process
GO:0006355	0.783	regulation of DNA-templated transcription
GO:0051173	0.652	positive regulation of nitrogen compound metabolic process
GO:0051716	0.644	cellular response to stimulus
GO:0009891	0.633	positive regulation of biosynthetic process
GO:0042221	0.623	response to chemical
GO:0070887	0.574	cellular response to chemical stimulus
GO:0010033	0.573	response to organic substance
GO:0045935	0.517	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.510	positive regulation of RNA metabolic process
GO:0010557	0.509	positive regulation of macromolecule biosynthetic process
GO:0031328	0.508	positive regulation of cellular biosynthetic process
GO:1902680	0.500	positive regulation of RNA biosynthetic process
GO:0071310	0.487	cellular response to organic substance
GO:1903508	0.485	positive regulation of nucleic acid-templated transcription
GO:0006357	0.484	regulation of transcription by RNA polymerase II
GO:0045893	0.475	positive regulation of DNA-templated transcription
GO:0045944	0.390	positive regulation of transcription by RNA polymerase II
GO:0006950	0.375	response to stress
GO:0048519	0.359	negative regulation of biological process
GO:0009607	0.328	response to biotic stimulus
GO:0044419	0.326	biological process involved in interspecies interaction between organisms
GO:0009605	0.325	response to external stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0016020	0.974	membrane
GO:0032991	0.957	protein-containing complex
GO:0071944	0.933	cell periphery
GO:0005886	0.906	plasma membrane
GO:0005667	0.882	transcription regulator complex
GO:0090575	0.714	RNA polymerase II transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]