StarFunc result for job id Q15746

User Input

>input (1914 residues)
MGDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYP
EPQVTWHRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVE
LTVEGSFAKQLGQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRF
SCKITGRPQPQVTWLKGNVPLQPSARVSVSEKNGMQVLEIHGVNQDDVGVYTCLVVNGSG
KASMSAELSIQGLDSANRSFVRETKATNSDVRKEVTNVISKESKLDSLEAAAKSKNCSSP
QRGGSPPWAANSQPQPPRESKLESCKDSPRTAPQTPVLQKTSSSITLQAARVQPEPRAPG
LGVLSPSGEERKRPAPPRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKP
QSQEVKENQTVKFRCEVSGIPKPEVAWFLEGTPVRRQEGSIEVYEDAGSHYLCLLKARTR
DSGTYSCTASNAQGQLSCSWTLQVERLAVMEVAPSFSSVLKDCAVIEGQDFVLQCSVRGT
PVPRITWLLNGQPIQYARSTCEAGVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTV
HEKKSSRKSEYLLPVAPSKPTAPIFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNG
NEIQESEDFHFEQRGTQHSLCIQEVFPEDTGTYTCEAWNSAGEVRTQAVLTVQEPHDGTQ
PWFISKPRSVTASLGQSVLISCAIAGDPFPTVHWLRDGKALCKDTGHFEVLQNEDVFTLV
LKKVQPWHAGQYEILLKNRVGECSCQVSLMLQNSSARALPRGREPASCEDLCGGGVGADG
GGSDRYGSLRPGWPARGQGWLEEEDGEDVRGVLKRRVETRQHTEEAIRQQEVEQLDFRDL
LGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVKPKTVSEEERKVHSPQQVDFRSVLAKK
GTSKTPVPEKVPPPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPS
GPLKPVGNAKPAETLKPMGNAKPAETLKPMGNAKPDENLKSASKEELKKDVKNDVNCKRG
HAGTTDNEKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLNGKTLKT
TKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTVDDAPASENTKAPE
MKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKVRAGESVELFGK
VTGTQPITCTWMKFRKQIQESEHMKVENSENGSKLTILAARQEHCGCYTLLVENKLGSRQ
AQVNLTVVDKPDPPAGTPCASDIRSSSLTLSWYGSSYDGGSAVQSYSIEIWDSANKTWKE
LATCRSTSFNVQDLLPDHEYKFRVRAINVYGTSEPSQESELTTVGEKPEEPKDEVEVSDD
DEKEPEVDYRTVTINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSA
KEKENIRQEISIMNCLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTER
ECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKV
LFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDF
DDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYM
ARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAV
AEEKPHVKPYFSKTIRDLEVVEGSAARFDCKIEGYPDPEVVWFKDDQSIRESRHFQIDYD
EDGNCSLIISDVCGDDDAKYTCKAVNSLGEATCTAELIVETMEEGEGEGEEEEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8C985	0.157	0.330	0.000	899	0.310	0.661	A8C985.pdb.gz
2	AFDB:Q15746	1.000	1.000	0.000	1914	1.000	1.000	Q15746.pdb.gz	MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK PE=1 SV=4
3	AFDB:O75147	0.112	0.113	6.167E-64	1896	0.142	0.143	O75147.pdb.gz	OBSL1_HUMAN Obscurin-like protein 1 OS=Homo sapiens OX=9606 GN=OBSL1 PE=1 SV=4
4	AFDB:B2RTX2	0.057	0.094	4.208E-51	1106	0.099	0.172	B2RTX2.pdb.gz	B2RTX2_HUMAN Palladin, cytoskeletal associated protein OS=Homo sapiens OX=9606 GN=PALLD PE=2 SV=1
5	AFDB:Q0E9F2	0.085	0.101	1.331E-47	1542	0.098	0.121	Q0E9F2.pdb.gz	Q0E9F2_DROME Sticks and stones, isoform B OS=Drosophila melanogaster OX=7227 GN=sns PE=1 SV=1
6	AFDB:Q9W213	0.063	0.079	3.577E-43	1395	0.092	0.127	Q9W213.pdb.gz	Q9W213_DROME Roundabout 1, isoform A OS=Drosophila melanogaster OX=7227 GN=robo1 PE=1 SV=3
7	AFDB:Q9Z2I4	0.090	0.118	7.544E-43	1366	0.101	0.142	Q9Z2I4.pdb.gz	ROBO3_MOUSE Roundabout homolog 3 OS=Mus musculus OX=10090 GN=Robo3 PE=1 SV=2
8	AFDB:Q96MS0	0.083	0.107	1.591E-42	1386	0.103	0.142	Q96MS0.pdb.gz	ROBO3_HUMAN Roundabout homolog 3 OS=Homo sapiens OX=9606 GN=ROBO3 PE=1 SV=2
9	AFDB:E7F5U2	0.080	0.067	2.617E-42	2497	0.106	0.081	E7F5U2.pdb.gz
10	AFDB:P13595	0.086	0.123	2.912E-39	1115	0.084	0.144	P13595.pdb.gz	NCAM1_MOUSE Neural cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ncam1 PE=1 SV=3
11	PDB:5oj2B	0.090	0.169	1.678E-30	692	0.076	0.211	5oj2B.pdb.gz
12	PDB:1e07A	0.069	0.162	7.002E-29	642	0.063	0.187	1e07A.pdb.gz
13	PDB:2x4fA	0.137	0.863	3.516E-26	289	0.073	0.481	2x4fA.pdb.gz	The Crystal Structure of the Human Myosin Light Chain Kinase Loc340156
14	PDB:2yaaA	0.146	0.883	8.608E-26	300	0.069	0.443	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.
15	PDB:5u6yA	0.142	0.573	5.465E-22	459	0.055	0.231	5u6yA.pdb.gz
16	PDB:3soaA	0.145	0.602	7.633E-21	436	0.054	0.236	3soaA.pdb.gz	A Mechanism for Tunable Autoinhibition in the Structure of a Human Ca(2+)/Calmodulin- Dependent Kinase II Holoenzyme.
17	PDB:8bfsA	0.130	0.822	9.183E-20	274	0.053	0.372	8bfsA.pdb.gz	Crystal structure of human calmodulin-dependent protein kinase 1D (CAMK1D) in complex with FZ326
18	PDB:4rgjA	0.132	0.518	1.417E-18	463	0.048	0.197	4rgjA.pdb.gz
19	PDB:6dldD	0.057	0.295	2.110E-18	269	0.029	0.208	6dldD.pdb.gz
20	PDB:7myjC	0.128	0.497	2.217E-18	465	0.045	0.187	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G1U9Q7	0.0	2477	1903	0.686	0.690	G1U9Q7_MELGA Myosin light chain kinase, smooth muscle OS=Meleagris gallopavo OX=9103 GN=MYLK PE=3 SV=3
2	Q15746	0.0	3957	1914	1.000	1.000	MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK PE=1 SV=4
3	Q6PDN3	0.0	3286	1941	0.847	0.835	MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus OX=10090 GN=Mylk PE=1 SV=3
4	A0A0B4JD64	6.37e-131	436	913	0.121	0.254	A0A0B4JD64_DROME Stretchin-Mlck, isoform M OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=3 SV=1
5	A1ZA69	7.74e-131	436	929	0.121	0.250	A1ZA69_DROME Stretchin-Mlck, isoform B OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=3 SV=1
6	O01653	1.29e-130	432	832	0.131	0.300	O01653_DROME Myosin light chain kinase isoform-II (Fragment) OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
7	O01651	1.31e-130	436	929	0.114	0.235	O01651_DROME Myosin light chain kinase isoform-I OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
8	A1ZA70	7.94e-127	419	732	0.108	0.281	A1ZA70_DROME Stretchin-Mlck, isoform G OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=4 SV=2
9	Q9GTV1	7.16e-126	416	732	0.108	0.281	Q9GTV1_DROME Stretchin-MLCK OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
10	Q9GV79	1.30e-125	417	786	0.100	0.244	Q9GV79_DROME Stretchin-MLCK (Fragment) OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
11	G4SLH0	1.07e-124	442	18562	0.147	0.015	TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans OX=6239 GN=ttn-1 PE=1 SV=2
12	A0A0B4JCU1	1.29e-124	408	602	0.110	0.349	A0A0B4JCU1_DROME Stretchin-Mlck, isoform N OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=3 SV=1
13	Q9GV81	5.67e-124	405	577	0.109	0.360	Q9GV81_DROME Stretchin-MLCK (Fragment) OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
14	O01652	1.04e-123	404	569	0.109	0.366	O01652_DROME Myosin light chain kinase isoform-III (Fragment) OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=2 SV=1
15	Q961U1	3.97e-123	431	1721	0.146	0.162	Q961U1_DROME GH07636p OS=Drosophila melanogaster OX=7227 GN=bt PE=2 SV=1
16	X2JD89	5.73e-122	433	8602	0.144	0.032	X2JD89_DROME Bent, isoform J OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1
17	L0MN91	5.93e-122	433	8866	0.144	0.031	L0MN91_DROME Bent, isoform I OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1
18	L0MPZ1	7.16e-122	432	8408	0.144	0.033	L0MPZ1_DROME Bent, isoform H OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1
19	D1YSG0	8.01e-122	432	8933	0.144	0.031	D1YSG0_DROME Bent, isoform F OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1
20	Q7KQP6	8.99e-122	432	8648	0.144	0.032	Q7KQP6_DROME Bent, isoform C OS=Drosophila melanogaster OX=7227 GN=bt PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16620 23ISL	5.2e-74	259.3	Unstructured linker between I-set domains 2 and 3 on MYLCK
2	PF18247 AvrM_N	3.5e+02	12.6	Flax-rust effector AvrM N-terminal domain
3	PF06832 BiPBP_C	0.00014	33.1	Penicillin-Binding Protein C-terminus Family
4	PF08205 C2-set_2	6.2e-21	85.6	CD80-like C2-set immunoglobulin domain
5	PF19250 DUF5898	1.2e+02	14.0	Family of unknown function (DUF5898)
6	PF00041 fn3	1.6e-12	58.9	Fibronectin type III domain
7	PF02480 Herpes_gE	28	15.6	Alphaherpesvirus glycoprotein E
8	PF20418 Herpes_gE_N	5.6	18.3	Alphaherpesvirus glycoprotein E N-terminal
9	PF07679 I-set	1.2e-200	661.6	Immunoglobulin I-set domain
10	PF00047 ig	1.2e-83	286.7	Immunoglobulin domain
11	PF13895 Ig_2	1.8e-74	257.4	Immunoglobulin domain
12	PF13927 Ig_3	5.4e-125	419.5	Immunoglobulin domain
13	PF16680 Ig_4	3.6e-07	42.0	T-cell surface glycoprotein CD3 delta chain
14	PF18452 Ig_6	0.49	21.7	Immunoglobulin domain
15	PF17736 Ig_C17orf99	3.4e-07	41.5	C17orf99 Ig domain
16	PF09134 Invasin_D3	64	15.5	Invasin, domain 3
17	PF16706 Izumo-Ig	0.34	22.2	Izumo-like Immunoglobulin domain
18	PF06293 Kdo	68	14.3	Lipopolysaccharide kinase (Kdo/WaaP) family
19	PF14531 Kinase-like	17	16.2	Kinase-like
20	PF00069 Pkinase	4.9e-73	257.3	Protein kinase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353452

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349467	0.994	Calmodulin-1
2	9606.ENSP00000365745	0.990	Contributes to the organization of the actin cytoskeleton and cell shape . Plays a role in the formation of lamellipodia and in cell migration. Plays a role in the regulation of neuron morphology, axon growth and formation of neuronal growth cones (By similarity). Through its interaction with CTTNBP2, involved in the regulation of neuronal spine density (By similarity). Plays a role in the invasiveness of cancer cells, and the formation of metastases . Plays a role in focal adhesion assembly and turnover (By similarity). In complex with ABL1 and MYLK regulates cortical actin-based cyto [...]
3	9606.ENSP00000217652	0.988	Myosin regulatory light chain 12A
4	9606.ENSP00000279022	0.988	Myosin regulatory light polypeptide 9
5	9606.ENSP00000379616	0.982	Myosin-11
6	9606.ENSP00000463559	0.981	Myosin regulatory light chain 12B
7	9606.ENSP00000223167	0.979	Myosin regulatory light chain 10
8	9606.ENSP00000228841	0.979	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
9	9606.ENSP00000272298	0.979	Calmodulin 2 (phosphorylase kinase, delta)
10	9606.ENSP00000325239	0.979	Myosin light chain, phosphorylatable, fast skeletal muscle
11	9606.ENSP00000450385	0.979	Myosin light chain 6B
12	9606.ENSP00000383023	0.978	Myosin light chain 5
13	9606.ENSP00000446955	0.978	Myosin light polypeptide 6
14	9606.ENSP00000223364	0.977	Myosin regulatory light chain 2, atrial isoform
15	9606.ENSP00000291295	0.969	Calmodulin 3 (phosphorylase kinase, delta)
16	9606.ENSP00000216181	0.963	Myosin-9
17	9606.ENSP00000353590	0.960	Myosin-10
18	9606.ENSP00000267257	0.957	Paxillin
19	9606.ENSP00000470298	0.951	Myosin-14
20	9606.ENSP00000389168	0.948	Protein phosphatase 1 regulatory subunit 12A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004687	0.999	myosin light chain kinase activity
GO:0005198	0.660	structural molecule activity
GO:0019899	0.564	enzyme binding
GO:0042802	0.409	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050896	0.990	response to stimulus
GO:0032501	0.990	multicellular organismal process
GO:0050789	0.981	regulation of biological process
GO:0050794	0.972	regulation of cellular process
GO:0032502	0.930	developmental process
GO:0048856	0.921	anatomical structure development
GO:0051716	0.905	cellular response to stimulus
GO:0016043	0.827	cellular component organization
GO:0042221	0.779	response to chemical
GO:0048518	0.757	positive regulation of biological process
GO:0048522	0.682	positive regulation of cellular process
GO:0048583	0.563	regulation of response to stimulus
GO:0009653	0.556	anatomical structure morphogenesis
GO:0008152	0.531	metabolic process
GO:0040012	0.458	regulation of locomotion
GO:2000145	0.443	regulation of cell motility
GO:0007275	0.434	multicellular organism development
GO:0030334	0.432	regulation of cell migration
GO:0006950	0.423	response to stress
GO:0071704	0.395	organic substance metabolic process
GO:0044238	0.388	primary metabolic process
GO:0032879	0.368	regulation of localization
GO:0048731	0.344	system development
GO:0009888	0.333	tissue development
GO:0048513	0.326	animal organ development
GO:0043170	0.323	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.998	intracellular organelle
GO:0005829	0.998	cytosol
GO:0005886	0.994	plasma membrane
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0043227	0.969	membrane-bounded organelle
GO:0005856	0.922	cytoskeleton
GO:0070161	0.914	anchoring junction
GO:0015629	0.910	actin cytoskeleton
GO:0043231	0.847	intracellular membrane-bounded organelle
GO:0005634	0.806	nucleus
GO:0031252	0.563	cell leading edge
GO:0120025	0.552	plasma membrane bounded cell projection
GO:0098590	0.531	plasma membrane region
GO:0042641	0.518	actomyosin
GO:0001725	0.506	stress fiber
GO:0032153	0.502	cell division site
GO:0030027	0.466	lamellipodium
GO:0032154	0.457	cleavage furrow
GO:0005925	0.336	focal adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:22004	0.999	ATP + L-seryl-[myosin light chain] = ADP + H(+) + O-phospho-L-seryl-[myosin light chain]
EC:2.7.11.18	0.999	[myosin light-chain] kinase.

[back to server]