StarFunc result for job id Q15750

User Input

>input (504 residues)
MAAQRRSLLQSEQQPSWTDDLPLCHLSGVGSASNRSYSADGKGTESHPPEDSWLKFRSEN
NCFLYGVFNGYDGNRVTNFVAQRLSAELLLGQLNAEHAEADVRRVLLQAFDVVERSFLES
IDDALAEKASLQSQLPEGVPQHQLPPQYQKILERLKTLEREISGGAMAVVAVLLNNKLYV
ANVGTNRALLCKSTVDGLQVTQLNVDHTTENEDELFRLSQLGLDAGKIKQVGIICGQEST
RRIGDYKVKYGYTDIDLLSAAKSKPIIAEPEIHGAQPLDGVTGFLVLMSEGLYKALEAAH
GPGQANQEIAAMIDTEFAKQTSLDAVAQAVVDRVKRIHSDTFASGGERARFCPRHEDMTL
LVRNFGYPLGEMSQPTPSPAPAAGGRVYPVSVPYSSAQSTSKTSVTLSLVMPSQGQMVNG
AHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEP
YVDFAEFYRLWSVDHGEQSVVTAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0U1RRU5	0.762	0.765	5.056E-91	502	0.962	0.966	A0A0U1RRU5.pdb.gz	A0A0U1RRU5_RAT TGF-beta activated kinase 1/MAP3K7 binding protein 1 OS=Rattus norvegicus OX=10116 GN=Tab1 PE=4 SV=2
2	AFDB:F1NEQ2	0.728	0.731	4.284E-83	502	0.903	0.906	F1NEQ2.pdb.gz
3	AFDB:Q6NUU7	0.712	0.721	5.942E-68	498	0.657	0.665	Q6NUU7.pdb.gz
4	PDB:5nzzD	0.702	0.930	2.269E-66	379	0.752	1.000	5nzzD.pdb.gz	The TAB1-p38 alpha complex aggravates myocardial injury and can be targeted by small molecules.
5	AFDB:Q8GY60	0.412	0.441	4.050E-18	468	0.149	0.160	Q8GY60.pdb.gz	P2C52_ARATH Probable protein phosphatase 2C 52 OS=Arabidopsis thaliana OX=3702 GN=At4g03415 PE=1 SV=1
6	AFDB:Q4PSE8	0.402	0.451	1.579E-17	447	0.181	0.204	Q4PSE8.pdb.gz	P2C71_ARATH Probable protein phosphatase 2C 71 OS=Arabidopsis thaliana OX=3702 GN=At5g24940 PE=2 SV=1
7	AFDB:Q9SL76	0.416	0.202	1.872E-17	1094	0.153	0.070	Q9SL76.pdb.gz	P2C19_ARATH Protein phosphatase 2C and cyclic nucleotide-binding/kinase domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At2g20050/At2g20040 PE=2 SV=2
8	AFDB:Q501F9	0.407	0.541	3.373E-16	370	0.141	0.192	Q501F9.pdb.gz	P2C67_ARATH Probable protein phosphatase 2C 67 OS=Arabidopsis thaliana OX=3702 GN=PP2C67 PE=1 SV=1
9	AFDB:Q9LUS8	0.447	0.456	5.015E-16	493	0.169	0.172	Q9LUS8.pdb.gz	P2C40_ARATH Probable protein phosphatase 2C 40 OS=Arabidopsis thaliana OX=3702 GN=At3g16560 PE=1 SV=1
10	PDB:4oicB	0.404	0.643	7.305E-15	305	0.153	0.252	4oicB.pdb.gz	Identification and characterization of ABA receptors in Oryza sativa
11	AFDB:O15743	0.438	0.233	5.868E-14	975	0.109	0.056	O15743.pdb.gz	SPNA_DICDI Protein spalten OS=Dictyostelium discoideum OX=44689 GN=spnA PE=1 SV=1
12	PDB:1a6qA	0.409	0.555	8.850E-14	363	0.111	0.154	1a6qA.pdb.gz	Crystal structure of the protein serine/threonine phosphatase 2C at 2.0 A resolution.
13	AFDB:D4A254	0.399	0.179	2.562E-13	1190	0.141	0.060	D4A254.pdb.gz	D4A254_RAT PH domain and leucine rich repeat protein phosphatase 2 OS=Rattus norvegicus OX=10116 GN=Phlpp2 PE=1 SV=4
14	PDB:4jndA	0.421	0.513	1.688E-12	408	0.093	0.115	4jndA.pdb.gz	Structural insight into Caenorhabditis elegans sex-determining protein FEM-2.
15	PDB:7kprA	0.362	0.442	8.736E-12	403	0.135	0.169	7kprA.pdb.gz	Structural basis for the specificity of PPM1H phosphatase for Rab GTPases.
16	PDB:2pk0A	0.356	0.663	3.604E-11	247	0.101	0.206	2pk0A.pdb.gz	Structure of Streptococcus agalactiae serine/threonine phosphatase. The subdomain conformation is coupled to the binding of a third metal ion
17	PDB:5d2uA	0.351	0.684	1.357E-9	240	0.103	0.217	5d2uA.pdb.gz	Structural and Biochemical Characterization of a Cyanobacterial PP2C Phosphatase Reveals Insights into Catalytic Mechanism and Substrate Recognition
18	PDB:6jkvA	0.305	0.598	5.407E-8	230	0.095	0.209	6jkvA.pdb.gz	Crystal structure of PppA from Pseudomonas aeruginosa, a key regulatory component of type VI secretion systems.
19	PDB:3w40A	0.246	0.537	9.408E-6	199	0.065	0.166	3w40A.pdb.gz	Structure of the RsbX phosphatase involved in the general stress response of Bacillus subtilis
20	PDB:6rreD	0.273	0.312	1.140E-4	427	0.071	0.084	6rreD.pdb.gz	Structural insight into the membrane targeting domain of the Legionella deAMPylase SidD.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0U1RRU5	0.0	977	524	0.948	0.912	A0A0U1RRU5_RAT TGF-beta activated kinase 1/MAP3K7 binding protein 1 OS=Rattus norvegicus OX=10116 GN=Tab1 PE=4 SV=2
2	A8K6K3	0.0	1040	504	1.000	1.000	A8K6K3_HUMAN Mitogen-activated protein kinase kinase kinase 7 interacting protein 1, isoform CRA_f OS=Homo sapiens OX=9606 GN=MAP3K7IP1 PE=2 SV=1
3	D4A6C6	0.0	986	492	0.940	0.963	D4A6C6_RAT TGF-beta activated kinase 1/MAP3K7 binding protein 1 OS=Rattus norvegicus OX=10116 GN=Tab1 PE=1 SV=2
4	Q15750	0.0	1040	504	1.000	1.000	TAB1_HUMAN TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 OS=Homo sapiens OX=9606 GN=TAB1 PE=1 SV=1
5	Q5ZJW3	0.0	778	438	0.772	0.888	Q5ZJW3_CHICK PPM-type phosphatase domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_15c17 PE=2 SV=1
6	Q8CF89	0.0	1016	502	0.972	0.976	TAB1_MOUSE TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 OS=Mus musculus OX=10090 GN=Tab1 PE=1 SV=2
7	G5EEM6	7.95e-17	84.3	386	0.194	0.254	TAB1_CAEEL TGF-beta-activated kinase 1 and MAP3K7-binding protein 1 OS=Caenorhabditis elegans OX=6239 GN=tap-1 PE=1 SV=1
8	O81716	3.24e-11	67.0	355	0.157	0.223	P2C21_ARATH Probable protein phosphatase 2C 21 OS=Arabidopsis thaliana OX=3702 GN=PPC4-2 PE=1 SV=1
9	Q9SZ53	4.22e-11	66.6	357	0.167	0.235	P2C60_ARATH Probable protein phosphatase 2C 60 OS=Arabidopsis thaliana OX=3702 GN=At4g31860 PE=2 SV=1
10	Q9LUS8	2.24e-09	62.0	493	0.171	0.174	P2C40_ARATH Probable protein phosphatase 2C 40 OS=Arabidopsis thaliana OX=3702 GN=At3g16560 PE=1 SV=1
11	Q84JI0	7.20e-09	60.1	404	0.125	0.156	P2C30_ORYSJ Probable protein phosphatase 2C 30 OS=Oryza sativa subsp. japonica OX=39947 GN=PP2C30 PE=1 SV=1
12	Q8RXV3	1.05e-08	58.9	311	0.127	0.206	P2C59_ARATH Probable protein phosphatase 2C 59 OS=Arabidopsis thaliana OX=3702 GN=WIN2 PE=1 SV=1
13	Q0JLP9	2.50e-08	58.5	467	0.133	0.143	P2C06_ORYSJ Probable protein phosphatase 2C 6 OS=Oryza sativa subsp. japonica OX=39947 GN=PP2C06 PE=1 SV=1
14	Q9S9Z7	2.50e-08	57.8	282	0.157	0.280	P2C10_ARATH Probable protein phosphatase 2C 10 OS=Arabidopsis thaliana OX=3702 GN=At1g34750 PE=2 SV=1
15	Q5PNS9	2.83e-08	58.2	400	0.179	0.225	P2C64_ARATH Probable protein phosphatase 2C 64 OS=Arabidopsis thaliana OX=3702 GN=PP2C64 PE=1 SV=1
16	Q4WTH5	4.02e-08	57.8	429	0.145	0.170	Q4WTH5_ASPFU Protein phosphatase 2C, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_1G09280 PE=3 SV=1
17	Q9H0C8	1.04e-07	56.6	392	0.131	0.168	ILKAP_HUMAN Integrin-linked kinase-associated serine/threonine phosphatase 2C OS=Homo sapiens OX=9606 GN=ILKAP PE=1 SV=1
18	Q6L4R7	1.07e-07	56.6	445	0.155	0.175	P2C53_ORYSJ Protein phosphatase 2C 53 OS=Oryza sativa subsp. japonica OX=39947 GN=PP2C53 PE=1 SV=1
19	Q6L5H6	1.31e-07	56.2	387	0.147	0.191	P2C50_ORYSJ Protein phosphatase 2C 50 OS=Oryza sativa subsp. japonica OX=39947 GN=PP2C50 PE=1 SV=1
20	Q4PSE8	1.43e-07	56.2	447	0.121	0.136	P2C71_ARATH Probable protein phosphatase 2C 71 OS=Arabidopsis thaliana OX=3702 GN=At5g24940 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00481 PP2C	3.6e-38	143.3	Protein phosphatase 2C

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000018508

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000016274	0.998	Mitogen-activated protein kinase kinase kinase 7
2	61853.ENSNLEP00000018580	0.998	TGF-beta activated kinase 1/MAP3K7 binding protein 2
3	61853.ENSNLEP00000021805	0.994	TNF receptor-associated factor 6, E3 ubiquitin protein ligase
4	61853.ENSNLEP00000010857	0.993	Mitogen-activated protein kinase 14
5	61853.ENSNLEP00000012346	0.993	TGF-beta activated kinase 1/MAP3K7 binding protein 3
6	61853.ENSNLEP00000013466	0.970	Receptor (TNFRSF)-interacting serine-threonine kinase 1
7	61853.ENSNLEP00000017924	0.967	Conserved helix-loop-helix ubiquitous kinase
8	61853.ENSNLEP00000018309	0.967	X-linked inhibitor of apoptosis
9	61853.ENSNLEP00000018813	0.961	Uncharacterized protein
10	61853.ENSNLEP00000000730	0.957	Mitogen-activated protein kinase 11
11	61853.ENSNLEP00000003153	0.956	Belongs to the protein kinase superfamily.
12	61853.ENSNLEP00000021784	0.954	Interleukin-1 receptor-associated kinase 4
13	61853.ENSNLEP00000005236	0.947	TNFRSF1A-associated via death domain
14	61853.ENSNLEP00000017716	0.947	Belongs to the protein kinase superfamily.
15	61853.ENSNLEP00000006067	0.942	Mitogen-activated protein kinase kinase kinase 14
16	61853.ENSNLEP00000002409	0.926	Receptor-interacting serine/threonine-protein kinase 2
17	61853.ENSNLEP00000006463	0.917	Myeloid differentiation primary response protein MyD88
18	61853.ENSNLEP00000019474	0.909	Belongs to the TNF receptor-associated factor family.
19	61853.ENSNLEP00000008730	0.883	Baculoviral IAP repeat containing 2
20	61853.ENSNLEP00000015614	0.879	Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140677	0.998	molecular function activator activity
GO:0030234	0.998	enzyme regulator activity
GO:0051019	0.996	mitogen-activated protein kinase binding
GO:0008047	0.934	enzyme activator activity
GO:0044877	0.903	protein-containing complex binding
GO:0003824	0.814	catalytic activity
GO:0140096	0.792	catalytic activity, acting on a protein
GO:0016787	0.374	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0019222	0.995	regulation of metabolic process
GO:0080090	0.994	regulation of primary metabolic process
GO:0060255	0.994	regulation of macromolecule metabolic process
GO:0051171	0.994	regulation of nitrogen compound metabolic process
GO:0048583	0.989	regulation of response to stimulus
GO:0048522	0.988	positive regulation of cellular process
GO:0048584	0.983	positive regulation of response to stimulus
GO:0031323	0.982	regulation of cellular metabolic process
GO:0065009	0.979	regulation of molecular function
GO:0051246	0.979	regulation of protein metabolic process
GO:0009987	0.978	cellular process
GO:0010604	0.978	positive regulation of macromolecule metabolic process
GO:1902531	0.967	regulation of intracellular signal transduction
GO:0050896	0.961	response to stimulus
GO:0045860	0.956	positive regulation of protein kinase activity
GO:0071900	0.953	regulation of protein serine/threonine kinase activity
GO:0051716	0.940	cellular response to stimulus
GO:0071902	0.935	positive regulation of protein serine/threonine kinase activity
GO:0007165	0.924	signal transduction
GO:0043408	0.898	regulation of MAPK cascade
GO:1902533	0.868	positive regulation of intracellular signal transduction
GO:0043410	0.470	positive regulation of MAPK cascade
GO:0002682	0.464	regulation of immune system process
GO:0007166	0.457	cell surface receptor signaling pathway
GO:0050776	0.450	regulation of immune response
GO:0008152	0.423	metabolic process
GO:0035556	0.417	intracellular signal transduction
GO:0002764	0.372	immune response-regulating signaling pathway
GO:0002684	0.370	positive regulation of immune system process
GO:0071704	0.353	organic substance metabolic process
GO:0050778	0.346	positive regulation of immune response
GO:0002376	0.323	immune system process
GO:0010468	0.321	regulation of gene expression
GO:0044238	0.316	primary metabolic process
GO:0006807	0.306	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.998	nucleoplasm
GO:0032991	0.985	protein-containing complex
GO:0016020	0.725	membrane
GO:0016604	0.417	nuclear body
GO:0012505	0.315	endomembrane system
GO:0031982	0.310	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.374	Hydrolases.

[back to server]