StarFunc result for job id Q15751

User Input

>input (1400 residues)
MATMIPPVKLKWLEHLNSSWITEDSESIATREGVAVLYSKLVSNKEVVPLPQQVLCLKGP
QLPDFERESLSSDEQDHYLDALLSSQLALAKMVCSDSPFAGALRKRLLVLQRVFYALSNK
YHDKGKVKQQQHSPESSSGSADVHSVSERPRSSTDALIEMGVRTGLSLLFALLRQSWMMP
VSGPGLSLCNDVIHTAIEVVSSLPPLSLANESKIPPMGLDCLSQVTTFLKGVTIPNSGAD
TLGRRLASELLLGLAAQRGSLRYLLEWIEMALGASAVVHTMEKGKLLSSQEGMISFDCFM
TILMQMRRSLGSSADRSQWREPTRTSDGLCSLYEAALCLFEEVCRMASDYSRTCASPDSI
QTGDAPIVSETCEVYVWGSNSSHQLVEGTQEKILQPKLAPSFSDAQTIEAGQYCTFVIST
DGSVRACGKGSYGRLGLGDSNNQSTLKKLTFEPHRSIKKVSSSKGSDGHTLAFTTEGEVF
SWGDGDYGKLGHGNSSTQKYPKLIQGPLQGKVVVCVSAGYRHSAAVTEDGELYTWGEGDF
GRLGHGDSNSRNIPTLVKDISNVGEVSCGSSHTIALSKDGRTVWSFGGGDNGKLGHGDTN
RVYKPKVIEALQGMFIRKVCAGSQSSLALTSTGQVYAWGCGACLGCGSSEATALRPKLIE
ELAATRIVDVSIGDSHCLALSHDNEVYAWGNNSMGQCGQGNSTGPITKPKKVSGLDGIAI
QQISAGTSHSLAWTALPRDRQVVAWHRPYCVDLEESTFSHLRSFLERYCDKINSEIPPLP
FPSSREHHSFLKLCLKLLSNHLALALAGGVATSILGRQAGPLRNLLFRLMDSTVPDEIQE
VVIETLSVGATMLLPPLRERMELLHSLLPQGPDRWESLSKGQRMQLDIILTSLQDHTHVA
SLLGYSSPSDAADLSSVCTGYGNLSDQPYGTQSCHPDTHLAEILMKTLLRNLGFYTDQAF
GELEKNSDKFLLGTSSSENSQPAHLHELLCSLQKQLLAFCHINNISENSSSVALLHKHLQ
LLLPHATDIYSRSANLLKESPWNGSVGEKLRDVIYVSAAGSMLCQIVNSLLLLPVSVARP
LLSYLLDLLPPLDCLNRLLPAADLLEDQELQWPLHGGPELIDPAGLPLPQPAQSWVWLVD
LERTIALLIGRCLGGMLQGSPVSPEEQDTAYWMKTPLFSDGVEMDTPQLDKCMSCLLEVA
LSGNEEQKPFDYKLRPEIAVYVDLALGCSKEPARSLWISMQDYAVSKDWDSATLSNESLL
DTVSRFVLAALLKHTNLLSQACGESRYQPGKHLSEVYRCVYKVRSRLLACKNLELIQTRS
SSRDRWISENQDSADVDPQEHSFTRTIDEEAEMEEQAERDREEGHPEPEDEEEEREHEVM
TAGKIFQCFLSAREVARSRD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BNF7	0.619	0.707	0.000	1203	0.841	0.979	Q8BNF7.pdb.gz	Q8BNF7_MOUSE E3 ubiquitin-protein ligase HERC1 (Fragment) OS=Mus musculus OX=10090 GN=Herc1 PE=2 SV=2
2	AFDB:E8NHA2	0.260	0.338	3.835E-28	1062	0.141	0.186	E8NHA2.pdb.gz	E8NHA2_DROME HECT and RLD domain containing E3 ubiquitin ligase 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Herc4 PE=1 SV=1
3	AFDB:Q5GLZ8	0.276	0.354	3.212E-27	1057	0.122	0.162	Q5GLZ8.pdb.gz	HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens OX=9606 GN=HERC4 PE=1 SV=1
4	AFDB:Q55CR5	0.259	0.180	7.514E-27	2044	0.146	0.100	Q55CR5.pdb.gz	Q55CR5_DICDI Regulator of chromosome condensation domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269934 PE=4 SV=1
5	AFDB:Q9FJG9	0.247	0.753	4.878E-25	445	0.092	0.290	Q9FJG9.pdb.gz	RUG3_ARATH RCC1 domain-containing protein RUG3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RUG3 PE=1 SV=1
6	AFDB:Q947D2	0.248	0.312	1.141E-24	1103	0.088	0.112	Q947D2.pdb.gz	PRAF1_ARATH PH, RCC1 and FYVE domains-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=PRAF1 PE=1 SV=1
7	AFDB:Q9FN03	0.234	0.735	2.288E-24	440	0.086	0.275	Q9FN03.pdb.gz	UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana OX=3702 GN=UVR8 PE=1 SV=1
8	AFDB:Q0WSJ9	0.242	0.836	3.240E-24	393	0.070	0.249	Q0WSJ9.pdb.gz	Q0WSJ9_ARATH Regulator of chromosome condensation (RCC1) family protein OS=Arabidopsis thaliana OX=3702 GN=At3g02510 PE=1 SV=1
9	AFDB:Q9LFS0	0.239	0.821	4.085E-24	396	0.074	0.260	Q9LFS0.pdb.gz	Q9LFS0_ARATH At5g16040 OS=Arabidopsis thaliana OX=3702 GN=At5g16040 PE=1 SV=1
10	AFDB:Q80YD6	0.240	0.696	5.151E-24	464	0.078	0.235	Q80YD6.pdb.gz	SRGEF_MOUSE Secretion-regulating guanine nucleotide exchange factor OS=Mus musculus OX=10090 GN=Sergef PE=2 SV=2
11	PDB:8gqeB	0.236	0.839	5.209E-24	386	0.086	0.311	8gqeB.pdb.gz
12	PDB:5xgsA	0.231	0.771	1.539E-18	398	0.064	0.226	5xgsA.pdb.gz
13	PDB:5tbkI	0.238	0.754	4.204E-18	419	0.069	0.232	5tbkI.pdb.gz
14	PDB:5t94A	0.239	0.702	5.301E-18	454	0.062	0.192	5t94A.pdb.gz
15	PDB:4d4oA	0.206	0.656	5.962E-13	414	0.049	0.167	4d4oA.pdb.gz	Structure of the Kti11/Kti13 Heterodimer and its Double Role in Modifications of tRNA and Eukaryotic Elongation Factor 2.
16	PDB:6bk8M	0.143	0.512	1.003E-6	326	0.025	0.107	6bk8M.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
17	PDB:7mq8LT	0.151	0.231	3.453E-6	869	0.052	0.084	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:7r5jD4	0.143	0.151	3.453E-6	1312	0.109	0.117	7r5jD4.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
19	PDB:7mqaLQ	0.137	0.216	3.589E-6	830	0.045	0.076	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:6qk7A	0.106	0.124	4.188E-6	1161	0.084	0.102	6qk7A.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PZP8	0.0	2837	4859	0.981	0.283	E9PZP8_MOUSE HECT and RLD domain containing E3 ubiquitin protein ligase family member 1 OS=Mus musculus OX=10090 GN=Herc1 PE=1 SV=1
2	Q15751	0.0	2877	4861	1.000	0.288	HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens OX=9606 GN=HERC1 PE=1 SV=2
3	Q8BNF7	0.0	2429	1203	0.843	0.981	Q8BNF7_MOUSE E3 ubiquitin-protein ligase HERC1 (Fragment) OS=Mus musculus OX=10090 GN=Herc1 PE=2 SV=2
4	Q4U2R1	1.69e-68	258	4836	0.166	0.048	HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus OX=10090 GN=Herc2 PE=1 SV=3
5	O95714	2.20e-68	258	4834	0.166	0.048	HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2
6	Q9FN03	3.15e-43	166	440	0.094	0.298	UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana OX=3702 GN=UVR8 PE=1 SV=1
7	E8NHA2	1.64e-39	162	1062	0.091	0.121	E8NHA2_DROME HECT and RLD domain containing E3 ubiquitin ligase 4, isoform C OS=Drosophila melanogaster OX=7227 GN=Herc4 PE=1 SV=1
8	Q947D2	3.80e-39	161	1103	0.088	0.112	PRAF1_ARATH PH, RCC1 and FYVE domains-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=PRAF1 PE=1 SV=1
9	Q9FJG9	2.26e-37	149	445	0.085	0.267	RUG3_ARATH RCC1 domain-containing protein RUG3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=RUG3 PE=1 SV=1
10	F1QEL3	2.04e-35	147	708	0.077	0.153	F1QEL3_DANRE Retinitis pigmentosa GTPase regulator b OS=Danio rerio OX=7955 GN=rpgrb PE=4 SV=1
11	Q6PAV2	2.00e-33	142	1057	0.073	0.096	HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus OX=10090 GN=Herc4 PE=1 SV=2
12	F1QM29	2.27e-33	143	1413	0.077	0.076	F1QM29_DANRE Retinitis pigmentosa GTPase regulator b OS=Danio rerio OX=7955 GN=rpgrb PE=4 SV=1
13	Q55CR5	4.28e-33	142	2044	0.079	0.054	Q55CR5_DICDI Regulator of chromosome condensation domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0269934 PE=4 SV=1
14	Q5GLZ8	1.16e-31	137	1057	0.069	0.092	HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens OX=9606 GN=HERC4 PE=1 SV=1
15	B8A4R1	4.48e-31	132	531	0.066	0.173	B8A4R1_DANRE RCC1 and BTB domain-containing protein 1 isoform X1 OS=Danio rerio OX=7955 GN=fj43a07 PE=1 SV=1
16	Q7ZVG0	4.48e-31	132	531	0.066	0.173	Q7ZVG0_DANRE RCC1 and BTB domain-containing protein 1 OS=Danio rerio OX=7955 GN=wu:fj43a07 PE=1 SV=1
17	Q9SRZ7	2.57e-30	132	1006	0.083	0.115	Q9SRZ7_ARATH F12P19.9 protein OS=Arabidopsis thaliana OX=3702 GN=At1g65920 PE=1 SV=1
18	Q9LFS0	4.63e-30	126	396	0.070	0.247	Q9LFS0_ARATH At5g16040 OS=Arabidopsis thaliana OX=3702 GN=At5g16040 PE=1 SV=1
19	O95199	5.95e-30	129	551	0.067	0.171	RCBT2_HUMAN RCC1 and BTB domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RCBTB2 PE=1 SV=1
20	Q99LJ7	1.37e-29	127	551	0.066	0.167	RCBT2_MOUSE RCC1 and BTB domain-containing protein 2 OS=Mus musculus OX=10090 GN=Rcbtb2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00415 RCC1	6e-71	246.2	Regulator of chromosome condensation (RCC1) repeat
2	PF13540 RCC1_2	1.2e-34	128.6	Regulator of chromosome condensation (RCC1) repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000008584

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000003130	0.972	Uncharacterized protein
2	60711.ENSCSAP00000016997	0.710	Uncharacterized protein
3	60711.ENSCSAP00000013065	0.705	RAN binding protein 2
4	60711.ENSCSAP00000016123	0.703	GTP-binding protein involved in nucleocytoplasmic transport. Required for the import of protein into the nucleus and also for RNA export. Involved in chromatin condensation and control of cell cycle.
5	60711.ENSCSAP00000012228	0.649	Tumor protein p53 binding protein 2
6	60711.ENSCSAP00000010774	0.641	RP1, axonemal microtubule associated
7	60711.ENSCSAP00000000042	0.634	Adenosine deaminase, tRNA-specific 1
8	60711.ENSCSAP00000015441	0.634	Karyopherin (importin) beta 1
9	60711.ENSCSAP00000000316	0.600	Nuclear transport factor 2
10	60711.ENSCSAP00000012984	0.583	Leucine rich repeat containing 28
11	60711.ENSCSAP00000002136	0.574	Ran GTPase activating protein 1
12	60711.ENSCSAP00000002022	0.561	Cytochrome c oxidase assembly homolog 15 (yeast)
13	60711.ENSCSAP00000000554	0.559	Functions in nuclear protein import.
14	60711.ENSCSAP00000003660	0.559	Functions in nuclear protein import.
15	60711.ENSCSAP00000008441	0.559	Functions in nuclear protein import.
16	60711.ENSCSAP00000008645	0.559	Sperm associated antigen 6
17	60711.ENSCSAP00000011871	0.559	Functions in nuclear protein import.
18	60711.ENSCSAP00000013730	0.559	Functions in nuclear protein import.
19	60711.ENSCSAP00000013794	0.559	Functions in nuclear protein import.
20	60711.ENSCSAP00000016968	0.559	Functions in nuclear protein import.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	0.991	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0061919	0.994	process utilizing autophagic mechanism
GO:0021533	0.993	cell differentiation in hindbrain
GO:0021697	0.993	cerebellar cortex formation
GO:0021692	0.993	cerebellar Purkinje cell layer morphogenesis
GO:0044248	0.991	cellular catabolic process
GO:0021537	0.990	telencephalon development
GO:0010507	0.990	negative regulation of autophagy
GO:0050885	0.989	neuromuscular process controlling balance
GO:0030030	0.985	cell projection organization
GO:0048699	0.985	generation of neurons
GO:0030182	0.984	neuron differentiation
GO:0006914	0.933	autophagy
GO:0021953	0.928	central nervous system neuron differentiation
GO:0120036	0.784	plasma membrane bounded cell projection organization
GO:0048666	0.684	neuron development
GO:0031175	0.653	neuron projection development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.854	endomembrane system
GO:0005794	0.610	Golgi apparatus
GO:0005634	0.319	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]