StarFunc result for job id Q15758

User Input

>input (541 residues)
MVADPPRDSKGLAAAEPTANGGLALASIEDQGAAAGGYCGSRDQVRRCLRANLLVLLTVV
AVVAGVALGLGVSGAGGALALGPERLSAFVFPGELLLRLLRMIILPLVVCSLIGGAASLD
PGALGRLGAWALLFFLVTTLLASALGVGLALALQPGAASAAINASVGAAGSAENAPSKEV
LDSFLDLARNIFPSNLVSAAFRSYSTTYEERNITGTRVKVPVGQEVEGMNILGLVVFAIV
FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIVEMEDVGLLFA
RLGKYILCCLLGHAIHGLLVLPLIYFLFTRKNPYRFLWGIVTPLATAFGTSSSSATLPLM
MKCVEENNGVAKHISRFILPIGATVNMDGAALFQCVAAVFIAQLSQQSLDFVKIITILVT
ATASSVGAAGIPAGGVLTLAIILEAVNLPVDHISLILAVDWLVDRSCTVLNVEGDALGAG
LLQNYVDRTESRSTEPELIQVKSELPLDPLPVPTEEGNPLLKHYRGPAGDATVASEKESV
M

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15758	1.000	1.000	1.169E-71	541	1.000	1.000	Q15758.pdb.gz	AAAT_HUMAN Neutral amino acid transporter B(0) OS=Homo sapiens OX=9606 GN=SLC1A5 PE=1 SV=2
2	AFDB:D3ZJ25	0.846	0.826	1.042E-57	554	0.806	0.787	D3ZJ25.pdb.gz	AAAT_RAT Neutral amino acid transporter B(0) OS=Rattus norvegicus OX=10116 GN=Slc1a5 PE=1 SV=4
3	AFDB:P51912	0.838	0.820	1.415E-57	553	0.815	0.797	P51912.pdb.gz	AAAT_MOUSE Neutral amino acid transporter B(0) OS=Mus musculus OX=10090 GN=Slc1a5 PE=1 SV=2
4	PDB:6mpbB	0.791	0.954	2.879E-48	446	0.824	1.000	6mpbB.pdb.gz	Cryo-EM structures of the human glutamine transporter SLC1A5 (ASCT2) in the outward-facing conformation.
5	AFDB:P43007	0.824	0.838	4.899E-46	532	0.586	0.596	P43007.pdb.gz	SATT_HUMAN Neutral amino acid transporter A OS=Homo sapiens OX=9606 GN=SLC1A4 PE=1 SV=1
6	AFDB:O35874	0.815	0.829	9.858E-46	532	0.558	0.568	O35874.pdb.gz	SATT_MOUSE Neutral amino acid transporter A OS=Mus musculus OX=10090 GN=Slc1a4 PE=1 SV=1
7	AFDB:P51906	0.789	0.816	2.212E-37	523	0.392	0.405	P51906.pdb.gz	EAA3_MOUSE Excitatory amino acid transporter 3 OS=Mus musculus OX=10090 GN=Slc1a1 PE=1 SV=2
8	AFDB:P24942	0.761	0.758	3.737E-37	543	0.399	0.398	P24942.pdb.gz	EAA1_RAT Excitatory amino acid transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc1a3 PE=1 SV=2
9	AFDB:D7RVR8	0.789	0.779	5.300E-37	548	0.379	0.374	D7RVR8.pdb.gz	D7RVR8_DANRE Amino acid transporter OS=Danio rerio OX=7955 GN=slc1a2a PE=2 SV=1
10	AFDB:P31597	0.783	0.808	1.114E-36	524	0.397	0.410	P31597.pdb.gz	EAA3_RABIT Excitatory amino acid transporter 3 OS=Oryctolagus cuniculus OX=9986 GN=SLC1A1 PE=1 SV=1
11	AFDB:Q10901	0.789	0.848	1.081E-35	503	0.348	0.374	Q10901.pdb.gz	EAA1_CAEEL Excitatory amino acid transporter OS=Caenorhabditis elegans OX=6239 GN=glt-1 PE=1 SV=2
12	PDB:7xr4A	0.422	0.534	1.449E-31	425	0.362	0.461	7xr4A.pdb.gz	Structural basis of ligand binding modes of human EAAT2.
13	PDB:7nsgA	0.409	0.512	1.050E-29	430	0.373	0.470	7nsgA.pdb.gz	Structure of human excitatory amino acid transporter 3 (EAAT3) in complex with HIP-B
14	PDB:7p4iA	0.405	0.508	3.416E-29	428	0.529	0.668	7p4iA.pdb.gz
15	PDB:6x15A	0.418	0.536	3.798E-18	419	0.242	0.313	6x15A.pdb.gz	Large domain movements through the lipid bilayer mediate substrate release and inhibition of glutamate transporters.
16	PDB:7p5cA	0.089	0.114	3.477E-2	392	0.116	0.161	7p5cA.pdb.gz
17	PDB:6s4mA	0.107	0.128	1.083E-1	426	0.155	0.197	6s4mA.pdb.gz
18	PDB:4dynA	0.107	0.122	1.290E-1	437	0.074	0.092	4dynA.pdb.gz	To be determined
19	PDB:7p5jA	0.096	0.119	2.378E-1	399	0.094	0.128	7p5jA.pdb.gz
20	PDB:4czbB	0.234	0.281	2.596E-1	419	0.096	0.124	4czbB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6GC77	0.0	759	552	0.800	0.784	A0A8I6GC77_RAT Amino acid transporter OS=Rattus norvegicus OX=10116 GN=Slc1a5 PE=3 SV=1
2	D3ZJ25	0.0	773	555	0.804	0.784	AAAT_RAT Neutral amino acid transporter B(0) OS=Rattus norvegicus OX=10116 GN=Slc1a5 PE=1 SV=4
3	M0QXM4	0.0	719	365	0.654	0.970	M0QXM4_HUMAN Amino acid transporter OS=Homo sapiens OX=9606 GN=SLC1A5 PE=1 SV=1
4	O35874	0.0	557	532	0.567	0.577	SATT_MOUSE Neutral amino acid transporter A OS=Mus musculus OX=10090 GN=Slc1a4 PE=1 SV=1
5	P43007	0.0	550	532	0.573	0.583	SATT_HUMAN Neutral amino acid transporter A OS=Homo sapiens OX=9606 GN=SLC1A4 PE=1 SV=1
6	P51912	0.0	822	553	0.821	0.803	AAAT_MOUSE Neutral amino acid transporter B(0) OS=Mus musculus OX=10090 GN=Slc1a5 PE=1 SV=2
7	Q15758	0.0	1071	541	1.000	1.000	AAAT_HUMAN Neutral amino acid transporter B(0) OS=Homo sapiens OX=9606 GN=SLC1A5 PE=1 SV=2
8	Q9Z1J7	0.0	764	539	0.800	0.803	Q9Z1J7_RAT Amino acid transporter OS=Rattus norvegicus OX=10116 GN=Slc1a5 PE=1 SV=1
9	P56564	1.31e-137	411	543	0.409	0.407	EAA1_MOUSE Excitatory amino acid transporter 1 OS=Mus musculus OX=10090 GN=Slc1a3 PE=1 SV=2
10	P43003	2.67e-137	410	542	0.409	0.408	EAA1_HUMAN Excitatory amino acid transporter 1 OS=Homo sapiens OX=9606 GN=SLC1A3 PE=1 SV=1
11	P46411	6.02e-137	409	542	0.407	0.406	EAA1_BOVIN Excitatory amino acid transporter 1 OS=Bos taurus OX=9913 GN=SLC1A3 PE=2 SV=1
12	P24942	9.78e-137	409	543	0.407	0.405	EAA1_RAT Excitatory amino acid transporter 1 OS=Rattus norvegicus OX=10116 GN=Slc1a3 PE=1 SV=2
13	P31597	2.23e-134	402	524	0.407	0.420	EAA3_RABIT Excitatory amino acid transporter 3 OS=Oryctolagus cuniculus OX=9986 GN=SLC1A1 PE=1 SV=1
14	O35544	1.59e-133	401	561	0.414	0.399	EAA4_MOUSE Excitatory amino acid transporter 4 OS=Mus musculus OX=10090 GN=Slc1a6 PE=1 SV=1
15	O35921	2.10e-132	398	561	0.412	0.398	EAA4_RAT Excitatory amino acid transporter 4 OS=Rattus norvegicus OX=10116 GN=Slc1a6 PE=1 SV=1
16	P48664	1.82e-131	396	564	0.410	0.394	EAA4_HUMAN Excitatory amino acid transporter 4 OS=Homo sapiens OX=9606 GN=SLC1A6 PE=1 SV=1
17	Q95135	7.52e-131	393	524	0.392	0.405	EAA3_BOVIN Excitatory amino acid transporter 3 OS=Bos taurus OX=9913 GN=SLC1A1 PE=2 SV=1
18	P51906	3.73e-128	386	523	0.394	0.407	EAA3_MOUSE Excitatory amino acid transporter 3 OS=Mus musculus OX=10090 GN=Slc1a1 PE=1 SV=2
19	P51907	1.05e-127	385	523	0.390	0.403	EAA3_RAT Excitatory amino acid transporter 3 OS=Rattus norvegicus OX=10116 GN=Slc1a1 PE=1 SV=1
20	P43005	2.71e-125	379	524	0.394	0.406	EAA3_HUMAN Excitatory amino acid transporter 3 OS=Homo sapiens OX=9606 GN=SLC1A1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00375 SDF	1.3e-115	398.3	Sodium:dicarboxylate symporter family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000444408

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419945	0.987	Syncytin-1
2	9606.ENSP00000367123	0.898	4F2 cell-surface antigen heavy chain
3	9606.ENSP00000261622	0.866	Large neutral amino acids transporter small subunit 1
4	9606.ENSP00000449756	0.835	Sodium-coupled neutral amino acid transporter 1
5	9606.ENSP00000394485	0.834	Na(+)/H(+) exchange regulatory cofactor NHE-RF3
6	9606.ENSP00000256689	0.832	Sodium-coupled neutral amino acid transporter 2
7	9606.ENSP00000317379	0.785	Glutaminase kidney isoform, mitochondrial
8	9606.ENSP00000280612	0.781	Cystine/glutamate transporter
9	9606.ENSP00000275493	0.778	Epidermal growth factor receptor
10	9606.ENSP00000320378	0.766	Large neutral amino acids transporter small subunit 2
11	9606.ENSP00000455064	0.754	Y+L amino acid transporter 2
12	9606.ENSP00000317904	0.736	Glycogen [starch] synthase, muscle
13	9606.ENSP00000310447	0.723	Glutaminase liver isoform, mitochondrial
14	9606.ENSP00000305302	0.720	Sodium-dependent neutral amino acid transporter B(0)AT1
15	9606.ENSP00000380150	0.719	Caspase recruitment domain-containing protein 11
16	9606.ENSP00000471683	0.705	Sodium-coupled neutral amino acid transporter 5
17	9606.ENSP00000365686	0.692	Solute carrier family 15 member 1
18	9606.ENSP00000481301	0.689	Sodium-coupled neutral amino acid transporter 3
19	9606.ENSP00000362306	0.687	Protein argonaute-4
20	9606.ENSP00000370128	0.678	High affinity cationic amino acid transporter 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015179	1.000	L-amino acid transmembrane transporter activity
GO:0015175	1.000	neutral L-amino acid transmembrane transporter activity
GO:0015172	1.000	acidic amino acid transmembrane transporter activity
GO:1901702	0.987	salt transmembrane transporter activity
GO:0015318	0.986	inorganic molecular entity transmembrane transporter activity
GO:0015075	0.986	monoatomic ion transmembrane transporter activity
GO:0005488	0.961	binding
GO:0015183	0.958	L-aspartate transmembrane transporter activity
GO:0005515	0.954	protein binding
GO:0015291	0.938	secondary active transmembrane transporter activity
GO:0008324	0.908	monoatomic cation transmembrane transporter activity
GO:0022853	0.902	active monoatomic ion transmembrane transporter activity
GO:0022890	0.891	inorganic cation transmembrane transporter activity
GO:0015293	0.868	symporter activity
GO:0015294	0.851	solute:monoatomic cation symporter activity
GO:0046873	0.767	metal ion transmembrane transporter activity
GO:0015370	0.699	solute:sodium symporter activity
GO:0005343	0.658	organic acid:sodium symporter activity
GO:0042887	0.616	amide transmembrane transporter activity
GO:0005416	0.537	amino acid:monoatomic cation symporter activity
GO:0005283	0.511	amino acid:sodium symporter activity
GO:0005313	0.494	L-glutamate transmembrane transporter activity
GO:0038023	0.389	signaling receptor activity
GO:0015501	0.351	glutamate:sodium symporter activity
GO:0015186	0.306	L-glutamine transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0006865	0.985	amino acid transport
GO:0015804	0.904	neutral amino acid transport
GO:0055085	0.793	transmembrane transport
GO:1905039	0.758	carboxylic acid transmembrane transport
GO:0003333	0.619	amino acid transmembrane transport
GO:0098657	0.531	import into cell
GO:0015807	0.523	L-amino acid transport
GO:1902475	0.478	L-alpha-amino acid transmembrane transport
GO:0098739	0.473	import across plasma membrane
GO:0065007	0.430	biological regulation
GO:0089718	0.379	amino acid import across plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0043226	0.996	organelle
GO:0043227	0.994	membrane-bounded organelle
GO:0031982	0.960	vesicle
GO:1903561	0.949	extracellular vesicle
GO:0070062	0.944	extracellular exosome
GO:0043231	0.744	intracellular membrane-bounded organelle
GO:0005737	0.664	cytoplasm
GO:0098590	0.365	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	0.699	Na(+)(in) = Na(+)(out)
RHEA:66336	0.494	L-glutamate(out) = L-glutamate(in)
RHEA:29031	0.351	L-glutamate(in) + 2 Na(+)(in) = L-glutamate(out) + 2 Na(+)(out)

[back to server]