StarFunc result for job id Q15762

User Input

>input (336 residues)
MDYPTLLLALLHVYRALCEEVLWHTSVPFAENMSLECVYPSMGILTQVEWFKIGTQQDSI
AIFSPTHGMVIRKPYAERVYFLNSTMASNNMTLFFRNASEDDVGYYSCSLYTYPQGTWQK
VIQVVQSDSFEAAVPSNSHIVSEPGKNVTLTCQPQMTWPVQAVRWEKIQPRQIDLLTYCN
LVHGRNFTSKFPRQIVSNCSHGRWSVIVIPDVTVSDSGLYRCYLQASAGENETFVMRLTV
AEGKTDNQYTLFVAGGTVLLLLFVISITTIIVIFLNRRRRRERRDLFTESWDTQKAPNNY
RSPISTSQPTNQSMDDTREDIYVNYPTFSRRPKTRV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15762	1.000	1.000	1.391E-62	336	1.000	1.000	Q15762.pdb.gz	CD226_HUMAN CD226 antigen OS=Homo sapiens OX=9606 GN=CD226 PE=1 SV=2
2	AFDB:Q8K4F0	0.694	0.700	1.210E-40	333	0.524	0.529	Q8K4F0.pdb.gz	CD226_MOUSE CD226 antigen OS=Mus musculus OX=10090 GN=Cd226 PE=1 SV=1
3	AFDB:A1L2D6	0.377	0.371	8.123E-25	344	0.247	0.241	A1L2D6.pdb.gz	A1L2D6_DANRE CD226 antigen precursor OS=Danio rerio OX=7955 GN=zgc:158817 PE=1 SV=1
4	AFDB:Q80UL9	0.285	0.254	1.299E-16	379	0.164	0.145	Q80UL9.pdb.gz	JAML_MOUSE Junctional adhesion molecule-like OS=Mus musculus OX=10090 GN=Jaml PE=1 SV=2
5	AFDB:K4PZ75	0.283	0.190	8.907E-15	510	0.205	0.135	K4PZ75.pdb.gz	K4PZ75_HUMAN Ig superfamily receptor LNIR OS=Homo sapiens OX=9606 GN=LNIR PE=2 SV=1
6	AFDB:P40200	0.275	0.165	1.693E-14	585	0.128	0.074	P40200.pdb.gz	TACT_HUMAN T-cell surface protein tactile OS=Homo sapiens OX=9606 GN=CD96 PE=1 SV=2
7	AFDB:B0CLV1	0.273	0.225	2.740E-14	428	0.199	0.157	B0CLV1.pdb.gz	B0CLV1_DANRE Endothelial cell-selective adhesion molecule precursor OS=Danio rerio OX=7955 GN=ESAM PE=2 SV=1
8	AFDB:Q9JLB9	0.288	0.180	2.891E-14	549	0.226	0.138	Q9JLB9.pdb.gz	NECT3_MOUSE Nectin-3 OS=Mus musculus OX=10090 GN=Nectin3 PE=1 SV=1
9	AFDB:Q8BVF6	0.273	0.227	7.180E-14	408	0.193	0.159	Q8BVF6.pdb.gz	Q8BVF6_MOUSE Ig-like domain-containing protein OS=Mus musculus OX=10090 GN=Pvr PE=2 SV=1
10	AFDB:Q9H6B4	0.262	0.238	7.991E-14	373	0.185	0.166	Q9H6B4.pdb.gz	CLMP_HUMAN CXADR-like membrane protein OS=Homo sapiens OX=9606 GN=CLMP PE=1 SV=1
11	PDB:5c6wJ	0.258	0.355	5.053E-12	238	0.098	0.139	5c6wJ.pdb.gz
12	PDB:6dlfA	0.240	0.331	1.550E-9	236	0.119	0.169	6dlfA.pdb.gz
13	PDB:6dldD	0.222	0.272	1.465E-7	269	0.113	0.141	6dldD.pdb.gz
14	PDB:1e07A	0.238	0.132	7.295E-7	642	0.101	0.053	1e07A.pdb.gz
15	PDB:1ngwH	0.279	0.397	8.119E-7	216	0.077	0.120	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
16	PDB:1igaA	0.280	0.213	1.119E-6	475	0.092	0.065	1igaA.pdb.gz
17	PDB:3oaiA	0.282	0.198	1.181E-6	488	0.074	0.051	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.
18	PDB:1zvoC	0.280	0.193	1.717E-6	512	0.119	0.078	1zvoC.pdb.gz
19	PDB:2ig2H	0.257	0.340	1.911E-6	238	0.116	0.164	2ig2H.pdb.gz
20	PDB:3o3uN	0.216	0.133	3.094E-6	580	0.098	0.057	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15762	0.0	702	336	1.000	1.000	CD226_HUMAN CD226 antigen OS=Homo sapiens OX=9606 GN=CD226 PE=1 SV=2
2	Q8K4F0	1.05e-112	332	333	0.530	0.535	CD226_MOUSE CD226 antigen OS=Mus musculus OX=10090 GN=Cd226 PE=1 SV=1
3	A1L2D6	1.22e-26	109	344	0.268	0.262	A1L2D6_DANRE CD226 antigen precursor OS=Danio rerio OX=7955 GN=zgc:158817 PE=1 SV=1
4	Q8BVF6	3.40e-10	63.2	408	0.137	0.113	Q8BVF6_MOUSE Ig-like domain-containing protein OS=Mus musculus OX=10090 GN=Pvr PE=2 SV=1
5	Q8K094	3.56e-10	63.2	408	0.137	0.113	Q8K094_MOUSE Poliovirus receptor OS=Mus musculus OX=10090 GN=Pvr PE=1 SV=1
6	Q91WP1	3.66e-10	62.8	408	0.137	0.113	Q91WP1_MOUSE Cd155 OS=Mus musculus OX=10090 GN=Pvr PE=2 SV=1
7	Q9JLB9	1.40e-09	61.6	549	0.113	0.069	NECT3_MOUSE Nectin-3 OS=Mus musculus OX=10090 GN=Nectin3 PE=1 SV=1
8	Q9NQS3	1.48e-09	61.2	549	0.113	0.069	NECT3_HUMAN Nectin-3 OS=Homo sapiens OX=9606 GN=NECTIN3 PE=1 SV=1
9	A0A8I5ZU75	3.51e-09	60.1	549	0.110	0.067	A0A8I5ZU75_RAT Nectin cell adhesion molecule 3 OS=Rattus norvegicus OX=10116 GN=Nectin3 PE=3 SV=1
10	D4A5C0	3.92e-09	60.1	528	0.110	0.070	D4A5C0_RAT Nectin cell adhesion molecule 3 OS=Rattus norvegicus OX=10116 GN=Nectin3 PE=1 SV=2
11	A0A8I6APZ5	5.17e-09	59.3	438	0.110	0.084	A0A8I6APZ5_RAT Nectin cell adhesion molecule 3 OS=Rattus norvegicus OX=10116 GN=Nectin3 PE=3 SV=1
12	P40200	3.93e-06	50.8	585	0.080	0.046	TACT_HUMAN T-cell surface protein tactile OS=Homo sapiens OX=9606 GN=CD96 PE=1 SV=2
13	Q3U0X8	1.81e-05	48.9	602	0.074	0.042	TACT_MOUSE T-cell surface protein tactile OS=Mus musculus OX=10090 GN=Cd96 PE=1 SV=1
14	Q60977	3.69e-05	47.4	415	0.131	0.106	Q60977_MOUSE Tumor-associated glycoprotein E4 OS=Mus musculus OX=10090 GN=Pvr PE=2 SV=1
15	Q9GL76	7.29e-05	46.6	515	0.116	0.076	NECT1_PIG Nectin-1 OS=Sus scrofa OX=9823 GN=NECTIN1 PE=1 SV=1
16	A4IJ70	7.35e-05	46.6	467	0.119	0.086	A4IJ70_DROME Dpr-interacting protein epsilon OS=Drosophila melanogaster OX=7227 GN=DIP-epsilon PE=1 SV=1
17	Q9JKF6	1.38e-04	45.8	515	0.116	0.076	NECT1_MOUSE Nectin-1 OS=Mus musculus OX=10090 GN=Nectin1 PE=1 SV=3
18	A0A8I5ZLI7	1.76e-04	45.4	447	0.077	0.058	A0A8I5ZLI7_RAT Nectin cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Nectin1 PE=1 SV=1
19	Q15223	3.03e-04	44.7	517	0.092	0.060	NECT1_HUMAN Nectin-1 OS=Homo sapiens OX=9606 GN=NECTIN1 PE=1 SV=3
20	Q925N6	3.04e-04	45.1	1320	0.077	0.020	IGSF1_RAT Immunoglobulin superfamily member 1 OS=Rattus norvegicus OX=10116 GN=Igsf1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07280 Ac110_PIF	83	14.4	Per os infectivity factor AC110
2	PF07679 I-set	4.4e-05	34.8	Immunoglobulin I-set domain
3	PF00047 ig	3.7e-05	35.1	Immunoglobulin domain
4	PF13895 Ig_2	2.7e-08	45.3	Immunoglobulin domain
5	PF13927 Ig_3	7.7e-09	47.3	Immunoglobulin domain
6	PF16680 Ig_4	14	17.7	T-cell surface glycoprotein CD3 delta chain
7	PF16681 Ig_5	0.068	24.9	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
8	PF16706 Izumo-Ig	0.44	21.8	Izumo-like Immunoglobulin domain
9	PF12273 RCR	1.1e+02	14.8	Chitin synthesis regulation, resistance to Congo red
10	PF19428 Sema4F_C	67	14.3	Semaphorin 4F C-terminal
11	PF07686 V-set	5.8e-14	63.6	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000280200

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252483	0.999	Nectin-2
2	9606.ENSP00000402060	0.999	Poliovirus receptor
3	9606.ENSP00000419085	0.971	T-cell immunoreceptor with Ig and ITIM domains
4	9606.ENSP00000480609	0.941	annotation not available
5	9606.ENSP00000349252	0.921	Integrin alpha-L
6	9606.ENSP00000240618	0.913	Killer cell lectin-like receptor subfamily K, member 1
7	9606.ENSP00000380948	0.897	Integrin beta-2
8	9606.ENSP00000342156	0.887	Natural cytotoxicity triggering receptor 3
9	9606.ENSP00000291890	0.871	Natural cytotoxicity triggering receptor 1
10	9606.ENSP00000362181	0.803	Natural cytotoxicity triggering receptor 2
11	9606.ENSP00000413079	0.792	MHC class I polypeptide-related sequence A
12	9606.ENSP00000371333	0.785	Natural killer cells antigen CD94
13	9606.ENSP00000438038	0.783	NKG2-A/NKG2-B type II integral membrane protein
14	9606.ENSP00000357036	0.771	SLAM family member 6
15	9606.ENSP00000357012	0.765	Natural killer cell receptor 2B4
16	9606.ENSP00000229708	0.763	UL16-binding protein 1
17	9606.ENSP00000433642	0.760	Low affinity immunoglobulin gamma Fc region receptor III-B
18	9606.ENSP00000291386	0.743	RNA polymerase II subunit A C-terminal domain phosphatase SSU72
19	9606.ENSP00000371327	0.727	NKG2-C type II integral membrane protein
20	9606.ENSP00000336769	0.712	Killer cell immunoglobulin-like receptor 2DL1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.961	signaling receptor binding
GO:0042802	0.954	identical protein binding
GO:0019899	0.946	enzyme binding
GO:0044877	0.932	protein-containing complex binding
GO:0019900	0.911	kinase binding
GO:0019901	0.893	protein kinase binding
GO:0050839	0.713	cell adhesion molecule binding
GO:0005178	0.613	integrin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0050794	0.992	regulation of cellular process
GO:0050896	0.989	response to stimulus
GO:0009987	0.988	cellular process
GO:0048584	0.988	positive regulation of response to stimulus
GO:0032101	0.983	regulation of response to external stimulus
GO:0048522	0.982	positive regulation of cellular process
GO:0002697	0.979	regulation of immune effector process
GO:0002833	0.976	positive regulation of response to biotic stimulus
GO:0002684	0.974	positive regulation of immune system process
GO:0050776	0.973	regulation of immune response
GO:0007154	0.971	cell communication
GO:0002717	0.950	positive regulation of natural killer cell mediated immunity
GO:0002822	0.949	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0002694	0.945	regulation of leukocyte activation
GO:0023051	0.938	regulation of signaling
GO:0010646	0.938	regulation of cell communication
GO:0002696	0.934	positive regulation of leukocyte activation
GO:0007165	0.930	signal transduction
GO:0009966	0.928	regulation of signal transduction
GO:0045954	0.902	positive regulation of natural killer cell mediated cytotoxicity
GO:0008037	0.810	cell recognition
GO:0002824	0.810	positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0002712	0.747	regulation of B cell mediated immunity
GO:0002714	0.643	positive regulation of B cell mediated immunity
GO:0019222	0.592	regulation of metabolic process
GO:0033003	0.583	regulation of mast cell activation
GO:0007155	0.500	cell adhesion
GO:0050854	0.476	regulation of antigen receptor-mediated signaling pathway
GO:0060255	0.472	regulation of macromolecule metabolic process
GO:0009893	0.456	positive regulation of metabolic process
GO:0010604	0.451	positive regulation of macromolecule metabolic process
GO:0010468	0.446	regulation of gene expression
GO:0010647	0.435	positive regulation of cell communication
GO:0023056	0.426	positive regulation of signaling
GO:0002376	0.389	immune system process
GO:0002889	0.386	regulation of immunoglobulin mediated immune response
GO:0009967	0.361	positive regulation of signal transduction
GO:0002891	0.339	positive regulation of immunoglobulin mediated immune response
GO:0032501	0.334	multicellular organismal process
GO:0048519	0.332	negative regulation of biological process
GO:0001817	0.312	regulation of cytokine production
GO:0001819	0.300	positive regulation of cytokine production

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0009986	0.999	cell surface
GO:0098857	0.866	membrane microdomain
GO:0045121	0.861	membrane raft

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]