StarFunc result for job id Q15768

User Input

>input (340 residues)
MGPPHSGPGGVRVGALLLLGVLGLVSGLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDL
LCPRARPPGPHSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEY
SPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKP
VSEMPMERDRGAAHSLEPGKENLPGDPTSNATSRGAEGPLPPPSMPAVAGAAGGLALLLL
GVAGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGGGGMGPREAEPGELGIALRGG
GAADPPFCPHYEKVSGDYGHPVYIVQDGPPQSPPNIYYKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A5HTT2	0.629	0.629	6.557E-58	340	0.956	0.956	A5HTT2.pdb.gz	A5HTT2_RAT Ephrin B3 OS=Rattus norvegicus OX=10116 GN=Efnb3 PE=2 SV=1
2	AFDB:Q502Q3	0.576	0.573	7.969E-37	342	0.550	0.547	Q502Q3.pdb.gz
3	AFDB:Q90Z32	0.458	0.466	1.087E-27	334	0.388	0.395	Q90Z32.pdb.gz	Q90Z32_DANRE Ephrin-B2b OS=Danio rerio OX=7955 GN=fc10d03 PE=2 SV=1
4	AFDB:A0A2R8Q1M3	0.437	0.406	1.781E-26	369	0.397	0.366	A0A2R8Q1M3.pdb.gz
5	AFDB:G5EEE7	0.367	0.441	1.048E-16	279	0.185	0.226	G5EEE7.pdb.gz	G5EEE7_CAEEL Ephrin RBD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=vab-2 PE=2 SV=1
6	AFDB:O44516	0.420	0.411	8.823E-14	348	0.162	0.158	O44516.pdb.gz	EFN4_CAEEL Ephrin-4 OS=Caenorhabditis elegans OX=6239 GN=efn-4 PE=1 SV=2
7	PDB:6mjrA	0.186	0.399	9.426E-3	128	0.032	0.086	6mjrA.pdb.gz	Two Tryptophans Are Better Than One in Accelerating Electron Flow through a Protein.
8	AFDB:Q9FN39	0.227	0.213	1.029E-2	370	0.129	0.119	Q9FN39.pdb.gz	ENL01_ARATH Early nodulin-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=ENODL1 PE=2 SV=1
9	PDB:3fszA	0.208	0.462	1.896E-2	129	0.044	0.116	3fszA.pdb.gz	Metal-binding loop length and not sequence dictates structure.
10	AFDB:Q8NHL6	0.144	0.088	2.669E-2	650	0.150	0.078	Q8NHL6.pdb.gz	LIRB1_HUMAN Leukocyte immunoglobulin-like receptor subfamily B member 1 OS=Homo sapiens OX=9606 GN=LILRB1 PE=1 SV=1
11	PDB:4bxsV	0.160	0.056	5.242E-2	1262	0.041	0.011	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
12	AFDB:P43146	0.151	0.045	5.721E-2	1447	0.124	0.029	P43146.pdb.gz	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
13	AFDB:Q5ANJ4	0.117	0.069	7.376E-2	743	0.124	0.057	Q5ANJ4.pdb.gz	TEC1_CANAL Transcription activator TEC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TEC1 PE=1 SV=1
14	PDB:4n2iA	0.139	0.082	7.675E-2	662	0.047	0.024	4n2iA.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.
15	PDB:5n4lA	0.163	0.064	8.715E-2	1034	0.053	0.017	5n4lA.pdb.gz	Rat ceruloplasmin: a new labile copper binding site and zinc/copper mosaic.
16	PDB:7d4yB	0.148	0.095	1.360E-1	601	0.044	0.025	7d4yB.pdb.gz
17	PDB:4n20A	0.134	0.082	1.449E-1	639	0.047	0.025	4n20A.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.
18	PDB:5lwxA	0.170	0.113	1.449E-1	554	0.050	0.031	5lwxA.pdb.gz	Structure and function of Aspergillus niger laccase McoG
19	PDB:6cjzA	0.156	0.414	1.544E-1	105	0.035	0.114	6cjzA.pdb.gz
20	PDB:2bo0A	0.132	0.134	1.753E-1	336	0.059	0.060	2bo0A.pdb.gz	High Resolution Structural Studies of Mutants Provide Insights Into Catalysis and Electron Transfer Processes in Copper Nitrite Reductase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A5HTT2	0.0	573	340	0.956	0.956	A5HTT2_RAT Ephrin B3 OS=Rattus norvegicus OX=10116 GN=Efnb3 PE=2 SV=1
2	G3V7D4	0.0	652	340	0.968	0.968	G3V7D4_RAT Ephrin B3 OS=Rattus norvegicus OX=10116 GN=Efnb3 PE=3 SV=1
3	O35393	0.0	573	340	0.956	0.956	EFNB3_MOUSE Ephrin-B3 OS=Mus musculus OX=10090 GN=Efnb3 PE=1 SV=1
4	Q15768	0.0	672	340	1.000	1.000	EFNB3_HUMAN Ephrin-B3 OS=Homo sapiens OX=9606 GN=EFNB3 PE=1 SV=1
5	Q90Z31	1.07e-113	335	331	0.538	0.553	Q90Z31_DANRE Ephrin B3 OS=Danio rerio OX=7955 GN=efnb3 PE=1 SV=1
6	P52800	8.95e-80	248	336	0.409	0.414	EFNB2_MOUSE Ephrin-B2 OS=Mus musculus OX=10090 GN=Efnb2 PE=1 SV=1
7	P52799	1.11e-79	248	333	0.397	0.405	EFNB2_HUMAN Ephrin-B2 OS=Homo sapiens OX=9606 GN=EFNB2 PE=1 SV=1
8	Q90Z32	4.42e-76	239	334	0.376	0.383	Q90Z32_DANRE Ephrin-B2b OS=Danio rerio OX=7955 GN=fc10d03 PE=2 SV=1
9	P98172	1.66e-75	238	346	0.412	0.405	EFNB1_HUMAN Ephrin-B1 OS=Homo sapiens OX=9606 GN=EFNB1 PE=1 SV=1
10	O73612	3.93e-75	236	334	0.394	0.401	EFNB1_CHICK Ephrin-B1 OS=Gallus gallus OX=9031 GN=EFNB1 PE=2 SV=1
11	P52796	1.72e-73	233	345	0.394	0.388	EFNB1_RAT Ephrin-B1 OS=Rattus norvegicus OX=10116 GN=Efnb1 PE=1 SV=1
12	P52795	1.74e-73	233	345	0.388	0.383	EFNB1_MOUSE Ephrin-B1 OS=Mus musculus OX=10090 GN=Efnb1 PE=1 SV=1
13	Q90Z33	1.02e-72	230	341	0.400	0.399	Q90Z33_DANRE Ephrin-B1 OS=Danio rerio OX=7955 GN=efnb1 PE=2 SV=1
14	O13097	7.16e-72	228	329	0.412	0.426	EFNB1_XENLA Ephrin-B1 OS=Xenopus laevis OX=8355 GN=efnb1 PE=1 SV=2
15	O73874	2.38e-71	226	332	0.406	0.416	EFNB2_DANRE Ephrin-B2a OS=Danio rerio OX=7955 GN=efnb2a PE=1 SV=1
16	A0A8I6AJ66	2.84e-61	200	305	0.365	0.407	A0A8I6AJ66_RAT Ephrin B2 OS=Rattus norvegicus OX=10116 GN=Efnb2 PE=3 SV=1
17	G5EEE7	8.97e-14	72.8	279	0.150	0.183	G5EEE7_CAEEL Ephrin RBD domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=vab-2 PE=2 SV=1
18	P97553	1.99e-13	70.5	205	0.132	0.220	EFNA1_RAT Ephrin-A1 OS=Rattus norvegicus OX=10116 GN=Efna1 PE=2 SV=2
19	P52793	3.21e-13	69.7	205	0.126	0.210	EFNA1_MOUSE Ephrin-A1 OS=Mus musculus OX=10090 GN=Efna1 PE=1 SV=1
20	P20827	3.72e-13	69.7	205	0.135	0.224	EFNA1_HUMAN Ephrin-A1 OS=Homo sapiens OX=9606 GN=EFNA1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00812 Ephrin	5.7e-40	148.0	Ephrin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000226091

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281821	0.999	Ephrin type-A receptor 4
2	9606.ENSP00000332118	0.997	Ephrin type-B receptor 3
3	9606.ENSP00000381097	0.991	Ephrin type-B receptor 1
4	9606.ENSP00000363763	0.990	Ephrin type-B receptor 2
5	9606.ENSP00000275815	0.965	Ephrin type-A receptor 1
6	9606.ENSP00000233154	0.952	Cytoplasmic protein NCK2
7	9606.ENSP00000481994	0.945	Ephrin type-B receptor 6
8	9606.ENSP00000362680	0.933	Proto-oncogene tyrosine-protein kinase Src
9	9606.ENSP00000240874	0.925	Kalirin
10	9606.ENSP00000383118	0.924	Cell division control protein 42 homolog
11	9606.ENSP00000350896	0.921	Ephrin type-B receptor 4
12	9606.ENSP00000300574	0.917	Adapter molecule crk
13	9606.ENSP00000407586	0.917	GTPase HRas
14	9606.ENSP00000246792	0.916	Ras-related protein R-Ras
15	9606.ENSP00000245323	0.912	Ephrin-B2
16	9606.ENSP00000256078	0.912	GTPase KRas
17	9606.ENSP00000370719	0.912	Intersectin-1
18	9606.ENSP00000204961	0.910	Ephrin-B1
19	9606.ENSP00000369981	0.910	Endophilin-A1
20	9606.ENSP00000348461	0.909	Ras-related C3 botulinum toxin substrate 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046875	1.000	ephrin receptor binding
GO:0003824	0.313	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.996	signal transduction
GO:0032502	0.988	developmental process
GO:0007166	0.986	cell surface receptor signaling pathway
GO:0007169	0.979	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048013	0.972	ephrin receptor signaling pathway
GO:0048522	0.887	positive regulation of cellular process
GO:0032501	0.870	multicellular organismal process
GO:0051128	0.868	regulation of cellular component organization
GO:0048856	0.792	anatomical structure development
GO:0007275	0.761	multicellular organism development
GO:0007267	0.676	cell-cell signaling
GO:0065008	0.641	regulation of biological quality
GO:0023051	0.623	regulation of signaling
GO:0010646	0.622	regulation of cell communication
GO:0048731	0.567	system development
GO:0044087	0.445	regulation of cellular component biogenesis
GO:0048519	0.441	negative regulation of biological process
GO:0007399	0.399	nervous system development
GO:0071840	0.391	cellular component organization or biogenesis
GO:0023056	0.387	positive regulation of signaling
GO:0016043	0.362	cellular component organization
GO:0010647	0.349	positive regulation of cell communication
GO:0048523	0.339	negative regulation of cellular process
GO:0050803	0.308	regulation of synapse structure or activity
GO:0051130	0.302	positive regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043226	0.988	organelle
GO:0030054	0.926	cell junction
GO:0005622	0.734	intracellular anatomical structure
GO:0043229	0.715	intracellular organelle
GO:0043227	0.708	membrane-bounded organelle
GO:0098590	0.688	plasma membrane region
GO:0045202	0.685	synapse
GO:0098794	0.490	postsynapse
GO:0098978	0.443	glutamatergic synapse
GO:0005829	0.399	cytosol
GO:0097060	0.336	synaptic membrane
GO:0045211	0.304	postsynaptic membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]