StarFunc result for job id Q15771

User Input

>input (203 residues)
MSMEDYDFLFKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIGVDFMIKTVEINGEKVKL
QIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLV
GNKIDLAERREVSQQRAEEFSEAQDMYYLETSAKESDNVEKLFLDLACRLISEARQNTLV
NNVSSPLPGEGKSISYLTCCNFN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8K5R1	0.862	0.862	8.553E-39	203	1.000	1.000	A8K5R1.pdb.gz	A8K5R1_HUMAN RAB30, member RAS oncogene family, isoform CRA_a OS=Homo sapiens OX=9606 GN=RAB30 PE=2 SV=1
2	AFDB:Q9VM50	0.855	0.780	9.532E-33	223	0.660	0.601	Q9VM50.pdb.gz	Q9VM50_DROME RE14786p OS=Drosophila melanogaster OX=7227 GN=Rab30 PE=2 SV=1
3	PDB:2ew1A	0.828	0.982	1.531E-32	171	0.837	0.994	2ew1A.pdb.gz	Crystal structure of RAB30 in complex with a GTP analogue
4	AFDB:P11620	0.866	0.866	8.024E-28	203	0.468	0.468	P11620.pdb.gz	YPT1_SCHPO GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ypt1 PE=1 SV=2
5	AFDB:A4FVK4	0.877	0.860	1.328E-27	207	0.443	0.435	A4FVK4.pdb.gz	A4FVK4_DANRE RAB8A, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab8 PE=1 SV=1
6	AFDB:O18339	0.868	0.805	1.328E-27	219	0.478	0.443	O18339.pdb.gz	O18339_DROME RE48347p OS=Drosophila melanogaster OX=7227 GN=Rab19 PE=2 SV=1
7	AFDB:P01123	0.854	0.843	1.605E-27	206	0.483	0.476	P01123.pdb.gz	YPT1_YEAST GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPT1 PE=1 SV=2
8	AFDB:G5EFC1	0.880	0.847	1.939E-27	211	0.463	0.445	G5EFC1.pdb.gz	G5EFC1_CAEEL Rab8 OS=Caenorhabditis elegans OX=6239 GN=rab-8 PE=1 SV=1
9	AFDB:Q5AI00	0.864	0.848	3.640E-27	207	0.473	0.464	Q5AI00.pdb.gz	Q5AI00_CANAL Rab family GTPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YPT1 PE=4 SV=1
10	AFDB:D6XMQ7	0.881	0.860	3.877E-27	208	0.463	0.452	D6XMQ7.pdb.gz	D6XMQ7_TRYB2 Small GTP-binding protein Rab1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.12O16.530 PE=4 SV=1
11	AFDB:P20790	0.825	0.806	4.988E-27	208	0.424	0.413	P20790.pdb.gz	RAB8A_DICDI Ras-related protein Rab-8A OS=Dictyostelium discoideum OX=44689 GN=rab8A PE=3 SV=1
12	PDB:5szhB	0.827	0.956	4.952E-24	175	0.409	0.474	5szhB.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
13	PDB:5szjA	0.814	0.942	4.952E-24	175	0.409	0.474	5szjA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
14	PDB:5sziA	0.825	0.960	5.617E-24	174	0.399	0.466	5sziA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
15	PDB:1zbdA	0.829	0.947	2.548E-23	177	0.355	0.407	1zbdA.pdb.gz	Structural basis of Rab effector specificity: crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A.
16	PDB:2f9mA	0.847	0.941	9.568E-23	182	0.355	0.396	2f9mA.pdb.gz	The crystal structure of the small GTPase Rab11b reveals critical differences relative to the Rab11a isoform.
17	PDB:6if2B	0.810	0.919	1.687E-22	178	0.429	0.489	6if2B.pdb.gz	Rab35/ACAP2 and Rab35/RUSC2 Complex Structures Reveal Molecular Basis for Effector Recognition by Rab35 GTPase.
18	PDB:8a4cB	0.813	0.968	3.259E-21	170	0.350	0.418	8a4cB.pdb.gz	Rep15 interacts with several Rab GTPases and has a distinct fold for a Rab effector.
19	PDB:1ukvY	0.805	0.828	2.026E-20	197	0.463	0.477	1ukvY.pdb.gz	Structure of Rab GDP-dissociation inhibitor in complex with prenylated YPT1 GTPase
20	PDB:2zetA	0.807	0.902	6.297E-20	181	0.340	0.381	2zetA.pdb.gz	Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K5R1	1.17e-151	420	203	1.000	1.000	A8K5R1_HUMAN RAB30, member RAS oncogene family, isoform CRA_a OS=Homo sapiens OX=9606 GN=RAB30 PE=2 SV=1
2	Q15771	1.17e-151	420	203	1.000	1.000	RAB30_HUMAN Ras-related protein Rab-30 OS=Homo sapiens OX=9606 GN=RAB30 PE=1 SV=2
3	E9PMJ1	1.19e-123	348	168	0.828	1.000	E9PMJ1_HUMAN RAB30, member RAS oncogene family (Fragment) OS=Homo sapiens OX=9606 GN=RAB30 PE=1 SV=1
4	H0YDK7	2.28e-104	299	167	0.714	0.868	H0YDK7_HUMAN RAB30, member RAS oncogene family (Fragment) OS=Homo sapiens OX=9606 GN=RAB30 PE=1 SV=1
5	E9PS06	1.11e-100	289	139	0.685	1.000	E9PS06_HUMAN RAB30, member RAS oncogene family (Fragment) OS=Homo sapiens OX=9606 GN=RAB30 PE=1 SV=1
6	Q9VM50	4.02e-95	278	223	0.631	0.574	Q9VM50_DROME RE14786p OS=Drosophila melanogaster OX=7227 GN=Rab30 PE=2 SV=1
7	E9PNB9	3.68e-87	254	122	0.596	0.992	E9PNB9_HUMAN RAB30, member RAS oncogene family OS=Homo sapiens OX=9606 GN=RAB30 PE=1 SV=1
8	E9PRF7	3.58e-82	241	114	0.562	1.000	E9PRF7_HUMAN RAB30, member RAS oncogene family (Fragment) OS=Homo sapiens OX=9606 GN=RAB30 PE=1 SV=1
9	Q86YS6	1.80e-67	207	212	0.488	0.467	RAB43_HUMAN Ras-related protein Rab-43 OS=Homo sapiens OX=9606 GN=RAB43 PE=1 SV=1
10	Q8CG50	4.18e-65	201	210	0.468	0.452	RAB43_MOUSE Ras-related protein Rab-43 OS=Mus musculus OX=10090 GN=Rab43 PE=1 SV=1
11	Q6FLX7	5.69e-64	198	206	0.498	0.490	Q6FLX7_CANGA Candida glabrata strain CBS138 chromosome K complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K12672g PE=4 SV=1
12	P01123	1.42e-62	194	206	0.468	0.461	YPT1_YEAST GTP-binding protein YPT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPT1 PE=1 SV=2
13	Q9U1W9	9.53e-62	192	210	0.468	0.452	Q9U1W9_CAEEL Ras-related protein Rab-43 OS=Caenorhabditis elegans OX=6239 GN=rab-19 PE=1 SV=1
14	Q5AI00	2.05e-61	192	207	0.424	0.415	Q5AI00_CANAL Rab family GTPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=YPT1 PE=4 SV=1
15	A4D1S5	6.85e-61	191	217	0.473	0.442	RAB19_HUMAN Ras-related protein Rab-19 OS=Homo sapiens OX=9606 GN=RAB19 PE=1 SV=2
16	P11620	4.71e-60	188	203	0.458	0.458	YPT1_SCHPO GTP-binding protein ypt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ypt1 PE=1 SV=2
17	P20791	9.88e-60	187	203	0.419	0.419	RAB8B_DICDI Ras-related protein Rab-8B OS=Dictyostelium discoideum OX=44689 GN=rab8B PE=2 SV=1
18	P61028	1.07e-59	187	207	0.438	0.430	RAB8B_MOUSE Ras-related protein Rab-8B OS=Mus musculus OX=10090 GN=Rab8b PE=1 SV=1
19	P70550	1.07e-59	187	207	0.438	0.430	RAB8B_RAT Ras-related protein Rab-8B OS=Rattus norvegicus OX=10116 GN=Rab8b PE=1 SV=1
20	A5PLC7	1.27e-59	187	209	0.433	0.421	A5PLC7_DANRE RAB8B, member RAS oncogene family OS=Danio rerio OX=7955 GN=rab8bb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	2.1	20.2	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	31	16.4	AAA ATPase domain
3	PF13401 AAA_22	38	16.0	AAA domain
4	PF13479 AAA_24	5.8e+02	11.6	AAA domain
5	PF13671 AAA_33	7.4	18.2	AAA domain
6	PF07728 AAA_5	7.6	18.0	AAA domain (dynein-related subfamily)
7	PF12775 AAA_7	5.5e+02	11.5	P-loop containing dynein motor region
8	PF00005 ABC_tran	3.8e+02	13.0	ABC transporter
9	PF00025 Arf	1.3e-11	55.8	ADP-ribosylation factor family
10	PF03029 ATP_bind_1	0.039	25.3	Conserved hypothetical ATP binding protein
11	PF02492 cobW	3.6e+02	12.1	CobW/HypB/UreG, nucleotide-binding domain
12	PF02421 FeoB_N	1.9	19.5	Ferrous iron transport protein B
13	PF00009 GTP_EFTU	0.037	25.1	Elongation factor Tu GTP binding domain
14	PF04670 Gtr1_RagA	2.5e-05	35.3	Gtr1/RagA G protein conserved region
15	PF01078 Mg_chelatase	3.2e+02	12.1	Magnesium chelatase, subunit ChlI
16	PF01926 MMR_HSR1	0.023	26.1	50S ribosome-binding GTPase
17	PF05729 NACHT	33	15.8	NACHT domain
18	PF03266 NTPase_1	1.1e+02	14.1	NTPase
19	PF10662 PduV-EutP	2.2	19.5	Ethanolamine utilisation - propanediol utilisation
20	PF00071 Ras	8.8e-55	196.2	Ras family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008842413.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008833204.1	0.804	Conserved oligomeric Golgi complex subunit 4
2	1026970.XP_008842486.1	0.698	Glycerophosphodiester phosphodiesterase domain-containing protein 4
3	1026970.XP_008853412.1	0.695	RAB20, member RAS oncogene family
4	1026970.XP_008842431.1	0.694	Aquaporin-11
5	1026970.XP_008852898.1	0.692	Ribosomal protein S28
6	1026970.XP_008825993.1	0.686	Conserved oligomeric Golgi complex subunit 3
7	1026970.XP_008832060.1	0.685	Conserved oligomeric Golgi complex subunit 8
8	1026970.XP_008829151.1	0.681	RAB24, member RAS oncogene family
9	1026970.XP_008820730.1	0.671	CHM, Rab escort protein 1
10	1026970.XP_008824709.1	0.671	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: deleted 1 base in 1 codon
11	1026970.XP_008847401.1	0.671	CHM like, Rab escort protein 2
12	1026970.XP_008844006.1	0.661	Conserved oligomeric Golgi complex subunit 2
13	1026970.XP_008829009.1	0.654	Conserved oligomeric Golgi complex subunit 5
14	1026970.XP_008826904.1	0.653	RAB34, member RAS oncogene family
15	1026970.XP_008832790.1	0.650	RAB21, member RAS oncogene family
16	1026970.XP_008826772.1	0.648	RAB7A, member RAS oncogene family
17	1026970.XP_008831972.1	0.641	RAB36, member RAS oncogene family
18	1026970.XP_008838647.1	0.640	RAB35, member RAS oncogene family
19	1026970.XP_008850353.1	0.640	RAB15, member RAS oncogene family
20	1026970.XP_008851109.1	0.640	RAB9A, member RAS oncogene family

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0016818	0.955	hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
GO:0017111	0.954	ribonucleoside triphosphate phosphatase activity
GO:0003924	0.942	GTPase activity
GO:0032555	0.800	purine ribonucleotide binding
GO:0043168	0.794	anion binding
GO:0032561	0.540	guanyl ribonucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0007030	0.941	Golgi organization
GO:0051179	0.659	localization
GO:0065007	0.568	biological regulation
GO:0051234	0.545	establishment of localization
GO:0006810	0.541	transport
GO:0050789	0.491	regulation of biological process
GO:0050794	0.425	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.980	endomembrane system
GO:0005737	0.961	cytoplasm
GO:0016020	0.813	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.1.-	0.955	In phosphorus-containing anhydrides.
RHEA:23680	0.954	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.954	nucleoside-triphosphate phosphatase.
RHEA:19669	0.942	GTP + H2O = GDP + H(+) + phosphate

[back to server]