StarFunc result for job id Q15772

User Input

>input (1400 residues)
MQKARGTRGEDAGTRAPPSPGVPPKRAKVGAGGGAPVAVAGAPVFLRPLKNAAVCAGSDV
RLRVVVSGTPQPSLRWFRDGQLLPAPAPEPSCLWLRRCGAQDAGVYSCMAQNERGRASCE
AVLTVLEVGDSETAEDDISDVQGTQRLELRDDGAFSTPTGGSDTLVGTSLDTPPTSVTGT
SEEQVSWWGSGQTVLEQEAGSGGGTRRLPGSPRQAQATGAGPRHLGVEPLVRASRANLVG
ASWGSEDSLSVASDLYGSAFSLYRGRALSIHVSVPQSGLRREEPDLQPQLASEAPRRPAQ
PPPSKSALLPPPSPRVGKRSPPGPPAQPAATPTSPHRRTQEPVLPEDTTTEEKRGKKSKS
SGPSLAGTAESRPQTPLSEASGRLSALGRSPRLVRAGSRILDKLQFFEERRRSLERSDSP
PAPLRPWVPLRKARSLEQPKSERGAPWGTPGASQEELRAPGSVAERRRLFQQKAASLDER
TRQRSPASDLELRFAQELGRIRRSTSREELVRSHESLRATLQRAPSPREPGEPPLFSRPS
TPKTSRAVSPAAAQPPSPSSAEKPGDEPGRPRSRGPAGRTEPGEGPQQEVRRRDQFPLTR
SRAIQECRSPVPPPAADPPEARTKAPPGRKREPPAQAVRFLPWATPGLEGAAVPQTLEKN
RAGPEAEKRLRRGPEEDGPWGPWDRRGARSQGKGRRARPTSPELESSDDSYVSAGEEPLE
APVFEIPLQNVVVAPGADVLLKCIITANPPPQVSWHKDGSALRSEGRLLLRAEGERHTLL
LREARAADAGSYMATATNELGQATCAASLTVRPGGSTSPFSSPITSDEEYLSPPEEFPEP
GETWPRTPTMKPSPSQNRRSSDTGSKAPPTFKVSLMDQSVREGQDVIMSIRVQGEPKPVV
SWLRNRQPVRPDQRRFAEEAEGGLCRLRILAAERGDAGFYTCKAVNEYGARQCEARLEVR
AHPESRSLAVLAPLQDVDVGAGEMALFECLVAGPTDVEVDWLCRGRLLQPALLKCKMHFD
GRKCKLLLTSVHEDDSGVYTCKLSTAKDELTCSARLTVRPSLAPLFTRLLEDVEVLEGRA
ARFDCKISGTPPPVVTWTHFGCPMEESENLRLRQDGGLHSLHIAHVGSEDEGLYAVSAVN
THGQAHCSAQLYVEEPRTAASGPSSKLEKMPSIPEEPEQGELERLSIPDFLRPLQDLEVG
LAKEAMLECQVTGLPYPTISWFHNGHRIQSSDDRRMTQYRDVHRLVFPAVGPQHAGVYKS
VIANKLGKAACYAHLYVTDVVPGPPDGAPQVVAVTGRMVTLTWNPPRSLDMAIDPDSLTY
TVQHQVLGSDQWTALVTGLREPGWAATGLRKGVQHIFRVLSTTVKSSSKPSPPSEPVQLL
EHGPTLEEAPAMLDKPDIVY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3V1M1	0.098	0.065	1.108E-39	2594	0.199	0.107	Q3V1M1.pdb.gz	IGS10_MOUSE Immunoglobulin superfamily member 10 OS=Mus musculus OX=10090 GN=Igsf10 PE=2 SV=2
2	AFDB:Q6WRH9	0.081	0.054	3.062E-36	2597	0.201	0.108	Q6WRH9.pdb.gz	IGS10_RAT Immunoglobulin superfamily member 10 OS=Rattus norvegicus OX=10116 GN=Igsf10 PE=1 SV=1
3	PDB:5oj2B	0.098	0.168	4.519E-30	692	0.086	0.175	5oj2B.pdb.gz
4	PDB:1e07A	0.109	0.201	4.726E-27	642	0.066	0.145	1e07A.pdb.gz
5	AFDB:B7YZW3	0.085	0.062	1.530E-22	2064	0.136	0.093	B7YZW3.pdb.gz	B7YZW3_DROME Miles to go, isoform E OS=Drosophila melanogaster OX=7227 GN=mtgo PE=1 SV=1
6	AFDB:E9Q4Y4	0.074	0.048	8.268E-22	2514	0.131	0.073	E9Q4Y4.pdb.gz	E9Q4Y4_MOUSE Centrosomal protein 192 OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1
7	AFDB:Q8TEP8	0.080	0.052	1.448E-20	2537	0.132	0.073	Q8TEP8.pdb.gz	CE192_HUMAN Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3
8	AFDB:Q90X22	0.083	0.090	7.063E-20	1276	0.126	0.138	Q90X22.pdb.gz
9	PDB:6dldD	0.092	0.344	3.414E-18	269	0.044	0.227	6dldD.pdb.gz
10	PDB:2rcjC	0.101	0.207	2.150E-17	523	0.061	0.164	2rcjC.pdb.gz
11	PDB:7sqcO0	0.071	0.083	2.039E-16	1140	0.054	0.067	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:4aq1A	0.087	0.131	3.399E-16	721	0.055	0.107	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
13	PDB:6dlfA	0.095	0.383	2.765E-15	236	0.039	0.233	6dlfA.pdb.gz
14	AFDB:M9NE05	0.129	0.094	3.417E-15	2192	0.086	0.055	M9NE05.pdb.gz	M9NE05_DROME Neuromusculin, isoform E OS=Drosophila melanogaster OX=7227 GN=nrm PE=4 SV=1
15	AFDB:Q54NE5	0.072	0.056	3.078E-14	1918	0.089	0.065	Q54NE5.pdb.gz	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
16	PDB:5a42A	0.081	0.074	2.244E-13	1597	0.057	0.050	5a42A.pdb.gz
17	PDB:4rtdA	0.058	0.071	4.145E-13	1122	0.041	0.052	4rtdA.pdb.gz
18	PDB:4ziqA	0.126	0.123	5.352E-13	1450	0.059	0.057	4ziqA.pdb.gz
19	AFDB:Q9V7H4	0.080	0.074	2.016E-7	1567	0.051	0.046	Q9V7H4.pdb.gz	TM131_DROME Transmembrane protein 131 homolog OS=Drosophila melanogaster OX=7227 GN=CG8370 PE=1 SV=2
20	AFDB:F6ZNL5	0.093	0.097	1.336E-6	1338	0.059	0.062	F6ZNL5.pdb.gz	F6ZNL5_MOUSE Protocadherin 11 X-linked OS=Mus musculus OX=10090 GN=Pcdh11x PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15772	0.0	2799	3267	1.000	0.429	SPEG_HUMAN Striated muscle preferentially expressed protein kinase OS=Homo sapiens OX=9606 GN=SPEG PE=1 SV=4
2	Q62407	0.0	2494	3262	0.929	0.399	SPEG_MOUSE Striated muscle-specific serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Speg PE=1 SV=2
3	Q63638	0.0	2485	3259	0.926	0.398	SPEG_RAT Striated muscle-specific serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Speg PE=1 SV=2
4	A0A8I5ZUN3	2.66e-45	183	35375	0.108	0.004	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
5	Q15746	5.80e-45	181	1914	0.093	0.068	MYLK_HUMAN Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK PE=1 SV=4
6	A2ASS6	7.20e-45	181	35213	0.108	0.004	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
7	O01761	1.33e-44	181	8081	0.108	0.019	UNC89_CAEEL Muscle M-line assembly protein unc-89 OS=Caenorhabditis elegans OX=6239 GN=unc-89 PE=1 SV=3
8	Q7TN00	1.54e-44	180	3410	0.108	0.044	Q7TN00_RAT Cardiac titin N2BA isoform (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=2
9	Q6PDN3	8.74e-44	177	1941	0.093	0.067	MYLK_MOUSE Myosin light chain kinase, smooth muscle OS=Mus musculus OX=10090 GN=Mylk PE=1 SV=3
10	Q8WZ42	5.94e-42	172	34350	0.108	0.004	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
11	M9PBJ1	6.51e-42	171	3664	0.106	0.041	M9PBJ1_DROME Zormin, isoform J OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=1
12	Q0E8J3	7.63e-42	171	3640	0.106	0.041	Q0E8J3_DROME Zormin, isoform I OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
13	M9PE03	1.11e-41	171	3536	0.106	0.042	M9PE03_DROME Zormin, isoform E OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=1
14	G1U9Q7	5.07e-41	168	1903	0.079	0.058	G1U9Q7_MELGA Myosin light chain kinase, smooth muscle OS=Meleagris gallopavo OX=9103 GN=MYLK PE=3 SV=3
15	Q0E8J4	1.05e-40	167	3079	0.106	0.048	Q0E8J4_DROME Zormin, isoform G OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
16	Q7Z1Y4	1.68e-40	167	2935	0.106	0.051	Q7Z1Y4_DROME Zormin OS=Drosophila melanogaster OX=7227 GN=zormin PE=4 SV=1
17	Q9W053	1.84e-40	167	2935	0.106	0.051	Q9W053_DROME Zormin, isoform F OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=4
18	Q0E8J5	2.51e-40	166	2960	0.106	0.050	Q0E8J5_DROME Zormin, isoform K OS=Drosophila melanogaster OX=7227 GN=zormin PE=1 SV=2
19	A8DYP0	5.85e-40	165	4218	0.134	0.044	OBSCN_DROME Obscurin OS=Drosophila melanogaster OX=7227 GN=Unc-89 PE=1 SV=1
20	A0A8I5ZU83	3.77e-38	159	26931	0.118	0.006	A0A8I5ZU83_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	1.6e-07	42.6	CD80-like C2-set immunoglobulin domain
2	PF00041 fn3	2.9	19.6	Fibronectin type III domain
3	PF07679 I-set	1.2e-112	379.6	Immunoglobulin I-set domain
4	PF00047 ig	1.3e-33	126.4	Immunoglobulin domain
5	PF13895 Ig_2	4.9e-36	134.2	Immunoglobulin domain
6	PF13927 Ig_3	1.4e-64	225.9	Immunoglobulin domain
7	PF16680 Ig_4	4.3	19.3	T-cell surface glycoprotein CD3 delta chain
8	PF16681 Ig_5	9.2	18.1	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
9	PF18452 Ig_6	1.5e-05	36.3	Immunoglobulin domain
10	PF16706 Izumo-Ig	0.97	20.7	Izumo-like Immunoglobulin domain
11	PF16650 SPEG_u2	2.2e-28	109.5	Unstructured region on SPEG complex protein
12	PF07686 V-set	1.8e-13	62.0	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311684

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359423	0.789	Myotubularin
2	9606.ENSP00000243776	0.743	Chondroitin sulfate synthase 2
3	9606.ENSP00000386857	0.736	Actin, gamma-enteric smooth muscle
4	9606.ENSP00000356379	0.629	Abnormal spindle-like microcephaly-associated protein
5	9606.ENSP00000350949	0.617	Mannose-1-phosphate guanyltransferase alpha
6	9606.ENSP00000402373	0.553	Actin, aortic smooth muscle
7	9606.ENSP00000362071	0.540	Junctophilin-2
8	9606.ENSP00000290378	0.538	Actin, alpha cardiac muscle 1
9	9606.ENSP00000355645	0.537	Actin, alpha skeletal muscle
10	9606.ENSP00000371267	0.537	14-3-3 protein theta
11	9606.ENSP00000257177	0.536	Terminal uridylyltransferase 4
12	9606.ENSP00000458162	0.532	Actin, cytoplasmic 2
13	9606.ENSP00000465260	0.526	Voltage-dependent calcium channel beta subunit-associated regulatory protein
14	9606.ENSP00000272298	0.507	Calmodulin 2 (phosphorylase kinase, delta)
15	9606.ENSP00000291295	0.507	Calmodulin 3 (phosphorylase kinase, delta)
16	9606.ENSP00000349467	0.507	Calmodulin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0061061	0.987	muscle structure development
GO:0009987	0.758	cellular process
GO:0065007	0.482	biological regulation
GO:0050789	0.473	regulation of biological process
GO:0048513	0.409	animal organ development
GO:0048731	0.399	system development
GO:0050794	0.383	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.997	intracellular organelle
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0005634	0.955	nucleus
GO:0005886	0.423	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]