StarFunc result for job id Q15784

User Input

>input (382 residues)
MLTRLFSEPGLLSDVPKFASWGDGEDDEPRSDKGDAPPPPPPAPGPGAPGPARAAKPVPL
RGEEGTEATLAEVKEEGELGGEEEEEEEEEEGLDEAEGERPKKRGPKKRKMTKARLERSK
LRRQKANARERNRMHDLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSG
KRPDLVSYVQTLCKGLSQPTTNLVAGCLQLNSRNFLTEQGADGAGRFHGSGGPFAMHPYP
YPCSRLAGAQCQAAGGLGGGAAHALRTHGYCAAYETLYAAAGGGGASPDYNSSEYEGPLS
PPLCLNGNFSLKQDSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVRGGVHSENLLS
YDMHLHHDRGPMYEELNAFFHN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q62414	0.548	0.547	3.700E-49	383	0.979	0.977	Q62414.pdb.gz	NDF2_MOUSE Neurogenic differentiation factor 2 OS=Mus musculus OX=10090 GN=Neurod2 PE=1 SV=3
2	AFDB:Q6NYU3	0.303	0.352	1.708E-21	327	0.445	0.520	Q6NYU3.pdb.gz	NDF6A_DANRE Neurogenic differentiation factor 6-A OS=Danio rerio OX=7955 GN=neurod6a PE=2 SV=1
3	AFDB:P79765	0.332	0.353	8.568E-21	357	0.458	0.490	P79765.pdb.gz	NDF1_CHICK Neurogenic differentiation factor 1 OS=Gallus gallus OX=9031 GN=NEUROD1 PE=2 SV=1
4	AFDB:Q9HD90	0.361	0.406	3.128E-19	331	0.403	0.465	Q9HD90.pdb.gz	NDF4_HUMAN Neurogenic differentiation factor 4 OS=Homo sapiens OX=9606 GN=NEUROD4 PE=1 SV=2
5	AFDB:A3KNX5	0.179	0.248	4.303E-4	271	0.183	0.258	A3KNX5.pdb.gz	BHA09_DANRE Class A basic helix-loop-helix protein 9 OS=Danio rerio OX=7955 GN=bhlha9 PE=2 SV=2
6	AFDB:P10084	0.165	0.182	2.013E-2	345	0.160	0.177	P10084.pdb.gz	AST4_DROME Achaete-scute complex protein T4 OS=Drosophila melanogaster OX=7227 GN=sc PE=1 SV=2
7	AFDB:O42913	0.100	0.108	2.425E-2	342	0.139	0.155	O42913.pdb.gz	NRM1_SCHPO Transcription factor nrm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nrm1 PE=1 SV=1
8	AFDB:Q7TN12	0.092	0.060	6.542E-2	663	0.162	0.094	Q7TN12.pdb.gz	INAVA_MOUSE Innate immunity activator protein OS=Mus musculus OX=10090 GN=Inava PE=2 SV=1
9	AFDB:A6NKF2	0.103	0.097	8.921E-2	412	0.191	0.177	A6NKF2.pdb.gz	ARI3C_HUMAN AT-rich interactive domain-containing protein 3C OS=Homo sapiens OX=9606 GN=ARID3C PE=1 SV=1
10	AFDB:O14948	0.162	0.177	9.492E-2	347	0.136	0.150	O14948.pdb.gz	TFEC_HUMAN Transcription factor EC OS=Homo sapiens OX=9606 GN=TFEC PE=1 SV=1
11	PDB:6mzcK	0.098	0.172	9.044E-1	202	0.063	0.119	6mzcK.pdb.gz
12	PDB:4f7rD	0.101	0.149	2.939	238	0.045	0.071	4f7rD.pdb.gz
13	PDB:1a0pA	0.094	0.124	3.540	271	0.010	0.015	1a0pA.pdb.gz
14	PDB:1zq1C	0.072	0.057	3.766	508	0.031	0.024	1zq1C.pdb.gz	Structural Basis for tRNA-Dependent Amidotransferase Function
15	PDB:1h7cA	0.095	0.294	4.007	103	0.021	0.078	1h7cA.pdb.gz
16	PDB:6vvoB	0.073	0.086	4.007	316	0.031	0.038	6vvoB.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism
17	PDB:6eu0Z	0.101	0.111	4.264	339	0.037	0.041	6eu0Z.pdb.gz	Structural basis of RNA polymerase III transcription initiation.
18	PDB:3j9xA	0.130	0.319	4.537	128	0.021	0.062	3j9xA.pdb.gz	A virus that infects a hyperthermophile encapsidates A-form DNA.
19	PDB:3l9wB	0.090	0.096	4.537	357	0.026	0.028	3l9wB.pdb.gz	Mechanism of ligand-gated potassium efflux in bacterial pathogens.
20	PDB:7edxH	0.099	0.157	4.537	209	0.055	0.100	7edxH.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15784	0.0	779	382	1.000	1.000	NDF2_HUMAN Neurogenic differentiation factor 2 OS=Homo sapiens OX=9606 GN=NEUROD2 PE=1 SV=2
2	Q62414	0.0	756	383	0.982	0.979	NDF2_MOUSE Neurogenic differentiation factor 2 OS=Mus musculus OX=10090 GN=Neurod2 PE=1 SV=3
3	Q64289	2.77e-97	295	357	0.411	0.440	NDF1_RAT Neurogenic differentiation factor 1 OS=Rattus norvegicus OX=10116 GN=Neurod1 PE=1 SV=1
4	Q60867	2.80e-97	295	357	0.411	0.440	NDF1_MOUSE Neurogenic differentiation factor 1 OS=Mus musculus OX=10090 GN=Neurod1 PE=1 SV=2
5	Q13562	2.86e-96	293	356	0.408	0.438	NDF1_HUMAN Neurogenic differentiation factor 1 OS=Homo sapiens OX=9606 GN=NEUROD1 PE=1 SV=3
6	P48986	4.78e-93	284	337	0.406	0.460	NDF6_MOUSE Neurogenic differentiation factor 6 OS=Mus musculus OX=10090 GN=Neurod6 PE=2 SV=1
7	Q6NYU3	3.82e-90	276	327	0.414	0.483	NDF6A_DANRE Neurogenic differentiation factor 6-A OS=Danio rerio OX=7955 GN=neurod6a PE=2 SV=1
8	Q91616	5.05e-90	276	352	0.387	0.420	NDF1_XENLA Neurogenic differentiation factor 1 OS=Xenopus laevis OX=8355 GN=neurod1 PE=1 SV=1
9	O42202	7.75e-89	273	350	0.380	0.414	NDF1_DANRE Neurogenic differentiation factor 1 OS=Danio rerio OX=7955 GN=neurod1 PE=1 SV=1
10	P79765	1.89e-85	265	357	0.416	0.445	NDF1_CHICK Neurogenic differentiation factor 1 OS=Gallus gallus OX=9031 GN=NEUROD1 PE=2 SV=1
11	Q9HD90	1.79e-66	215	331	0.340	0.393	NDF4_HUMAN Neurogenic differentiation factor 4 OS=Homo sapiens OX=9606 GN=NEUROD4 PE=1 SV=2
12	O09105	5.36e-66	214	330	0.332	0.385	NDF4_MOUSE Neurogenic differentiation factor 4 OS=Mus musculus OX=10090 GN=Neurod4 PE=1 SV=1
13	D4A7M5	9.42e-64	208	330	0.325	0.376	D4A7M5_RAT Neurogenic differentiation factor OS=Rattus norvegicus OX=10116 GN=Neurod4 PE=4 SV=1
14	F1QWM8	3.38e-57	192	348	0.325	0.356	F1QWM8_DANRE Neurogenic differentiation factor OS=Danio rerio OX=7955 GN=ath3 PE=4 SV=1
15	P79920	9.26e-51	174	315	0.293	0.356	NDF4_XENLA Neurogenic differentiation factor 4 OS=Xenopus laevis OX=8355 GN=neurod4 PE=1 SV=1
16	P46581	3.04e-28	111	192	0.144	0.286	NDF1_CAEEL Neurogenic differentiation factor 1 OS=Caenorhabditis elegans OX=6239 GN=cnd-1 PE=2 SV=1
17	O42606	1.66e-19	88.2	208	0.120	0.221	NGN1_DANRE Neurogenin-1 OS=Danio rerio OX=7955 GN=neurog1 PE=2 SV=1
18	Q9Y4Z2	2.34e-19	87.8	214	0.123	0.220	NGN3_HUMAN Neurogenin-3 OS=Homo sapiens OX=9606 GN=NEUROG3 PE=1 SV=2
19	P70447	5.20e-19	87.8	263	0.107	0.156	NGN2_MOUSE Neurogenin-2 OS=Mus musculus OX=10090 GN=Neurog2 PE=1 SV=1
20	P70661	5.40e-19	86.7	214	0.110	0.196	NGN3_MOUSE Neurogenin-3 OS=Mus musculus OX=10090 GN=Neurog3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15794 CCDC106	4.4	18.5	Coiled-coil domain-containing protein 106
2	PF00010 HLH	3.5e-12	57.4	Helix-loop-helix DNA-binding domain
3	PF12533 Neuro_bHLH	8.5e-42	154.7	Neuronal helix-loop-helix transcription factor
4	PF07767 Nop53	2.7e+02	12.3	Nop53 (60S ribosomal biogenesis)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306754

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000352544	0.916	Complexin-2
2	9606.ENSP00000396103	0.780	Myelin transcription factor 1-like protein
3	9606.ENSP00000339109	0.739	Anaphase-promoting complex subunit 1
4	9606.ENSP00000361540	0.729	Cell division cycle protein 20 homolog
5	9606.ENSP00000266744	0.692	Achaete-scute homolog 1
6	9606.ENSP00000374205	0.687	T-box brain protein 1
7	9606.ENSP00000311083	0.602	Cyclin-dependent kinases regulatory subunit 1
8	9606.ENSP00000381382	0.579	Transcription factor 4
9	9606.ENSP00000221498	0.572	Dickkopf-like protein 1
10	9606.ENSP00000329170	0.564	POU domain, class 3, transcription factor 2
11	9606.ENSP00000385899	0.561	Protein sidekick-1
12	9606.ENSP00000404100	0.539	Paired box protein Pax-6
13	9606.ENSP00000300658	0.521	Post-GPI attachment to proteins factor 3
14	9606.ENSP00000463653	0.516	RNA binding protein fox-1 homolog 3
15	9606.ENSP00000302189	0.513	Helix-loop-helix protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000978	0.999	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.980	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0046982	0.979	protein heterodimerization activity
GO:0070888	0.973	E-box binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0048856	0.968	anatomical structure development
GO:0032501	0.960	multicellular organismal process
GO:0007275	0.944	multicellular organism development
GO:0060255	0.923	regulation of macromolecule metabolic process
GO:0048731	0.917	system development
GO:0051171	0.911	regulation of nitrogen compound metabolic process
GO:0080090	0.909	regulation of primary metabolic process
GO:1903506	0.895	regulation of nucleic acid-templated transcription
GO:0006355	0.894	regulation of DNA-templated transcription
GO:0007399	0.865	nervous system development
GO:0009987	0.850	cellular process
GO:0006357	0.836	regulation of transcription by RNA polymerase II
GO:0048522	0.819	positive regulation of cellular process
GO:0048513	0.527	animal organ development
GO:0051254	0.445	positive regulation of RNA metabolic process
GO:0045893	0.320	positive regulation of DNA-templated transcription
GO:0050896	0.317	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.581	cytoplasm
GO:0070013	0.539	intracellular organelle lumen
GO:0031981	0.533	nuclear lumen
GO:0005654	0.394	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]