StarFunc result for job id Q15788

User Input

>input (1441 residues)
MSGLGDSSSDPANPDSHKRKGSPCDTLASSTEKRRREQENKYLEELAELLSANISDIDSL
SVKPDKCKILKKTVDQIQLMKRMEQEKSTTDDDVQKSDISSSSQGVIEKESLGPLLLEAL
DGFFFVVNCEGRIVFVSENVTSYLGYNQEELMNTSVYSILHVGDHAEFVKNLLPKSLVNG
VPWPQEATRRNSHTFNCRMLIHPPDEPGTENQEACQRYEVMQCFTVSQPKSIQEDGEDFQ
SCLICIARRLPRPPAITGVESFMTKQDTTGKIISIDTSSLRAAGRTGWEDLVRKCIYAFF
QPQGREPSYARQLFQEVMTRGTASSPSYRFILNDGTMLSAHTKCKLCYPQSPDMQPFIMG
IHIIDREHSGLSPQDDTNSGMSIPRVNPSVNPSISPAHGVARSSTLPPSNSNMVSTRINR
QQSSDLHSSSHSNSSNSQGSFGCSPGSQIVANVALNQGQASSQSSNPSLNLNNSPMEGTG
ISLAQFMSPRRQVTSGLATRPRMPNNSFPPNISTLSSPVGMTSSACNNNNRSYSNIPVTS
LQGMNEGPNNSVGFSASSPVLRQMSSQNSPSRLNIQPAKAESKDNKEIASILNEMIQSDN
SSSDGKPLDSGLLHNNDRLSDGDSKYSQTSHKLVQLLTTTAEQQLRHADIDTSCKDVLSC
TGTSNSASANSSGGSCPSSHSSLTERHKILHRLLQEGSPSDITTLSVEPDKKDSASTSVS
VTGQVQGNSSIKLELDASKKKESKDHQLLRYLLDKDEKDLRSTPNLSLDDVKVKVEKKEQ
MDPCNTNPTPMTKPTPEEIKLEAQSQFTADLDQFDQLLPTLEKAAQLPGLCETDRMDGAV
TSVTIKSEILPASLQSATARPTSRLNRLPELELEAIDNQFGQPGTGDQIPWTNNTVTAIN
QSKSEDQCISSQLDELLCPPTTVEGRNDEKALLEQLVSFLSGKDETELAELDRALGIDKL
VQGGGLDVLSERFPPQQATPPLIMEERPNLYSQPYSSPSPTANLPSPFQGMVRQKPSLGT
MPVQVTPPRGAFSPGMGMQPRQTLNRPPAAPNQLRLQLQQRLQGQQQLIHQNRQAILNQF
AATAPVGINMRSGMQQQITPQPPLNAQMLAQRQRELYSQQHRQRQLIQQQRAMLMRQQSF
GNNLPPSSGLPVQMGNPRLPQGAPQQFPYPPNYGTNPGTPPASTSPFSQLAANPEASLAN
RNSMVSRGMTGNIGGQFGTGINPQMQQNVFQYPGAGMVPQGEANFAPSLSPGSSMVPMPI
PPPQSSLLQQTPPASGYQSPDMKAWQQGAIGNNNVFSQAVQNQPTPAQPGVYNNMSITVS
MAGGNTNVQNMNPMMAQMQMSSLQMPGMNTVCPEQINDPALRHTGLYCNQLSSTDLLKTE
ADGTQQVQQVQVFADVQCTVNLVGGDPYLNQPGPLGTQKPTSGPQTPQAQQKSLLQQLLT
E

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4A3Q3	0.114	0.115	0.000	1417	0.865	0.880	D4A3Q3.pdb.gz	D4A3Q3_RAT Nuclear receptor coactivator OS=Rattus norvegicus OX=10116 GN=Ncoa1 PE=1 SV=2
2	AFDB:P70365	0.252	0.251	0.000	1447	0.928	0.924	P70365.pdb.gz	NCOA1_MOUSE Nuclear receptor coactivator 1 OS=Mus musculus OX=10090 GN=Ncoa1 PE=1 SV=2
3	AFDB:Q9W705	0.223	0.214	4.990E-65	1516	0.368	0.350	Q9W705.pdb.gz	NCOA2_XENLA Nuclear receptor coactivator 2 OS=Xenopus laevis OX=8355 GN=ncoa2 PE=2 SV=1
4	AFDB:Q98TW1	0.247	0.238	2.281E-64	1505	0.369	0.353	Q98TW1.pdb.gz	NCOA2_DANRE Nuclear receptor coactivator 2 OS=Danio rerio OX=7955 GN=ncoa2 PE=1 SV=1
5	AFDB:Q9WUI9	0.255	0.251	5.997E-62	1465	0.365	0.359	Q9WUI9.pdb.gz	NCOA2_RAT Nuclear receptor coactivator 2 OS=Rattus norvegicus OX=10116 GN=Ncoa2 PE=1 SV=1
6	AFDB:Q9Y6Q9	0.184	0.186	8.104E-58	1424	0.338	0.342	Q9Y6Q9.pdb.gz	NCOA3_HUMAN Nuclear receptor coactivator 3 OS=Homo sapiens OX=9606 GN=NCOA3 PE=1 SV=1
7	AFDB:O57539	0.172	0.178	1.084E-55	1391	0.337	0.349	O57539.pdb.gz	NCOA3_XENLA Nuclear receptor coactivator 3 OS=Xenopus laevis OX=8355 GN=ncoa3 PE=1 SV=1
8	AFDB:O09000	0.182	0.187	5.630E-52	1398	0.307	0.316	O09000.pdb.gz	NCOA3_MOUSE Nuclear receptor coactivator 3 OS=Mus musculus OX=10090 GN=Ncoa3 PE=1 SV=2
9	AFDB:Q24167	0.106	0.102	1.068E-24	1507	0.169	0.161	Q24167.pdb.gz	SIMA_DROME Protein similar OS=Drosophila melanogaster OX=7227 GN=sima PE=1 SV=2
10	AFDB:E1JIM6	0.113	0.149	1.219E-20	1015	0.117	0.166	E1JIM6.pdb.gz	E1JIM6_DROME Spineless, isoform C OS=Drosophila melanogaster OX=7227 GN=ss PE=1 SV=2
11	PDB:6umzA	0.061	0.511	9.543E-4	127	0.011	0.126	6umzA.pdb.gz	Structural and spectroscopic characterization of photoactive yellow protein and photoswitchable fluorescent protein constructs containing heavy atoms.
12	PDB:2wkpA	0.060	0.221	7.238E-3	320	0.015	0.069	2wkpA.pdb.gz	A Genetically Encoded Photoactivatable Rac Controls the Motility of Living Cells.
13	PDB:7q3dB	0.053	0.140	7.657E-3	453	0.012	0.040	7q3dB.pdb.gz
14	PDB:6xlbC1	0.032	0.111	1.015E-2	284	0.015	0.074	6xlbC1.pdb.gz
15	PDB:6xlfC	0.028	0.088	2.497E-2	316	0.018	0.082	6xlfC.pdb.gz	Cryo-EM structures reveal a multistep mechanism of Hsp90 activation by co-chaperone Aha1
16	PDB:3pcoB	0.043	0.062	5.490E-2	795	0.020	0.036	3pcoB.pdb.gz	Idiosyncrasy and identity in the prokaryotic phe-system: crystal structure of E. coli phenylalanyl-tRNA synthetase complexed with phenylalanine and AMP.
17	PDB:7rzwB	0.054	0.085	6.876E-2	864	0.022	0.036	7rzwB.pdb.gz	Plant phytochrome B is an asymmetric dimer with unique signalling potential.
18	PDB:2bi0A	0.035	0.116	8.612E-2	330	0.012	0.052	2bi0A.pdb.gz
19	PDB:7d9tA	0.035	0.082	9.110E-2	512	0.014	0.039	7d9tA.pdb.gz	Activation mechanism of human soluble guanylate cyclase by stimulators and activators.
20	PDB:1vmoA	0.026	0.145	1.351E-1	163	0.015	0.129	1vmoA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JZG4	0.0	2372	1401	0.847	0.871	A0A0G2JZG4_RAT Nuclear receptor coactivator OS=Rattus norvegicus OX=10116 GN=Ncoa1 PE=1 SV=2
2	A0A8I6APA0	0.0	2538	1460	0.891	0.879	A0A8I6APA0_RAT Nuclear receptor coactivator OS=Rattus norvegicus OX=10116 GN=Ncoa1 PE=1 SV=1
3	A0A8I6GLM3	0.0	2624	1443	0.918	0.917	A0A8I6GLM3_RAT Nuclear receptor coactivator OS=Rattus norvegicus OX=10116 GN=Ncoa1 PE=1 SV=1
4	B5MCN7	0.0	2527	1248	0.858	0.990	B5MCN7_HUMAN Nuclear receptor coactivator 1 OS=Homo sapiens OX=9606 GN=NCOA1 PE=1 SV=1
5	D4A3Q3	0.0	2400	1417	0.858	0.873	D4A3Q3_RAT Nuclear receptor coactivator OS=Rattus norvegicus OX=10116 GN=Ncoa1 PE=1 SV=2
6	P70365	0.0	2582	1447	0.916	0.912	NCOA1_MOUSE Nuclear receptor coactivator 1 OS=Mus musculus OX=10090 GN=Ncoa1 PE=1 SV=2
7	Q15596	0.0	581	1464	0.264	0.260	NCOA2_HUMAN Nuclear receptor coactivator 2 OS=Homo sapiens OX=9606 GN=NCOA2 PE=1 SV=2
8	Q15788	0.0	2948	1441	1.000	1.000	NCOA1_HUMAN Nuclear receptor coactivator 1 OS=Homo sapiens OX=9606 GN=NCOA1 PE=1 SV=3
9	Q7TPU7	0.0	676	1393	0.380	0.393	Q7TPU7_MOUSE Nuclear receptor coactivator OS=Mus musculus OX=10090 GN=Ncoa2 PE=2 SV=1
10	Q61026	5.64e-180	577	1462	0.263	0.259	NCOA2_MOUSE Nuclear receptor coactivator 2 OS=Mus musculus OX=10090 GN=Ncoa2 PE=1 SV=3
11	Q9WUI9	5.99e-177	569	1465	0.262	0.257	NCOA2_RAT Nuclear receptor coactivator 2 OS=Rattus norvegicus OX=10116 GN=Ncoa2 PE=1 SV=1
12	Q9W705	2.15e-167	545	1516	0.263	0.250	NCOA2_XENLA Nuclear receptor coactivator 2 OS=Xenopus laevis OX=8355 GN=ncoa2 PE=2 SV=1
13	Q98TW1	3.33e-160	525	1505	0.244	0.234	NCOA2_DANRE Nuclear receptor coactivator 2 OS=Danio rerio OX=7955 GN=ncoa2 PE=1 SV=1
14	Q9Y6Q9	2.19e-141	471	1424	0.236	0.239	NCOA3_HUMAN Nuclear receptor coactivator 3 OS=Homo sapiens OX=9606 GN=NCOA3 PE=1 SV=1
15	O57539	3.81e-140	467	1391	0.240	0.249	NCOA3_XENLA Nuclear receptor coactivator 3 OS=Xenopus laevis OX=8355 GN=ncoa3 PE=1 SV=1
16	O09000	2.09e-122	418	1398	0.224	0.231	NCOA3_MOUSE Nuclear receptor coactivator 3 OS=Mus musculus OX=10090 GN=Ncoa3 PE=1 SV=2
17	Q9EPU2	1.36e-27	124	1082	0.113	0.151	NCOA3_RAT Nuclear receptor coactivator 3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Ncoa3 PE=2 SV=1
18	Q98SJ5	3.96e-20	99.4	745	0.060	0.115	SIM1A_DANRE Single-minded homolog 1-A OS=Danio rerio OX=7955 GN=sim1a PE=2 SV=1
19	P81133	1.26e-19	97.8	766	0.064	0.120	SIM1_HUMAN Single-minded homolog 1 OS=Homo sapiens OX=9606 GN=SIM1 PE=1 SV=2
20	E1C5G3	1.65e-19	97.4	766	0.064	0.120	E1C5G3_CHICK SIM bHLH transcription factor 1 OS=Gallus gallus OX=9031 GN=SIM1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07469 DUF1518	1.6e-25	100.6	Nuclear receptor coactivator, DUF1518
2	PF16279 DUF4927	0.036	26.4	Domain of unknown function (DUF4927)
3	PF00010 HLH	0.19	23.0	Helix-loop-helix DNA-binding domain
4	PF16665 NCOA_u2	4.1e-18	77.2	Unstructured region on nuclear receptor coactivator protein
5	PF08815 Nuc_rec_co-act	1.3e-17	74.7	Nuclear receptor coactivator
6	PF00989 PAS	0.00019	32.8	PAS fold
7	PF14598 PAS_11	4.5e-37	138.0	PAS domain
8	PF18095 PAS_12	3.4e+02	12.1	UPF0242 C-terminal PAS-like domain
9	PF08447 PAS_3	0.00046	31.7	PAS fold
10	PF08448 PAS_4	6.3e+02	12.0	PAS fold
11	PF13426 PAS_9	0.048	25.3	PAS domain
12	PF08832 SRC-1	3.5e-18	77.6	Steroid receptor coactivator

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385216

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231509	0.999	Glucocorticoid receptor
2	9606.ENSP00000262367	0.999	CREB-binding protein
3	9606.ENSP00000263253	0.999	Histone acetyltransferase p300
4	9606.ENSP00000287820	0.999	Peroxisome proliferator-activated receptor gamma
5	9606.ENSP00000336528	0.999	Nuclear receptor subfamily 1 group I member 2
6	9606.ENSP00000343925	0.999	Estrogen receptor beta
7	9606.ENSP00000363822	0.999	Androgen receptor
8	9606.ENSP00000385523	0.999	Peroxisome proliferator-activated receptor alpha
9	9606.ENSP00000405330	0.999	Estrogen receptor
10	9606.ENSP00000419692	0.999	Retinoic acid receptor RXR-alpha
11	9606.ENSP00000254066	0.998	Retinoic acid receptor alpha
12	9606.ENSP00000447173	0.998	Vitamin D3 receptor
13	9606.ENSP00000300134	0.997	Signal transducer and activator of transcription 6
14	9606.ENSP00000447149	0.997	Bile acid receptor
15	9606.ENSP00000477707	0.997	Oxysterols receptor LXR-alpha
16	9606.ENSP00000325120	0.996	Progesterone receptor
17	9606.ENSP00000332296	0.994	Retinoic acid receptor beta
18	9606.ENSP00000263754	0.993	Histone acetyltransferase KAT2B
19	9606.ENSP00000379904	0.993	Thyroid hormone receptor beta
20	9606.ENSP00000264637	0.992	Thyroid hormone receptor alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016922	1.000	nuclear receptor binding
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0140110	0.999	transcription regulator activity
GO:0044877	0.999	protein-containing complex binding
GO:0030331	0.990	nuclear estrogen receptor binding
GO:0042974	0.988	nuclear retinoic acid receptor binding
GO:0046965	0.982	nuclear retinoid X receptor binding
GO:0003712	0.978	transcription coregulator activity
GO:0003713	0.958	transcription coactivator activity
GO:0003682	0.904	chromatin binding
GO:0019899	0.505	enzyme binding
GO:0033142	0.307	nuclear progesterone receptor binding
GO:0030374	0.304	nuclear receptor coactivator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.987	response to stimulus
GO:0045893	0.985	positive regulation of DNA-templated transcription
GO:0009987	0.984	cellular process
GO:0042221	0.978	response to chemical
GO:0045944	0.975	positive regulation of transcription by RNA polymerase II
GO:0032501	0.971	multicellular organismal process
GO:0010033	0.967	response to organic substance
GO:0051716	0.958	cellular response to stimulus
GO:0070887	0.918	cellular response to chemical stimulus
GO:0033993	0.904	response to lipid
GO:0048856	0.897	anatomical structure development
GO:0007275	0.868	multicellular organism development
GO:0009719	0.840	response to endogenous stimulus
GO:1901700	0.832	response to oxygen-containing compound
GO:0048511	0.830	rhythmic process
GO:0065008	0.822	regulation of biological quality
GO:0050878	0.805	regulation of body fluid levels
GO:0048545	0.795	response to steroid hormone
GO:0048513	0.780	animal organ development
GO:0021536	0.769	diencephalon development
GO:0051179	0.763	localization
GO:0032355	0.760	response to estradiol
GO:0007617	0.751	mating behavior
GO:0007548	0.740	sex differentiation
GO:0060180	0.739	female mating behavior
GO:0048732	0.719	gland development
GO:0030879	0.713	mammary gland development
GO:1901654	0.710	response to ketone
GO:0021761	0.700	limbic system development
GO:0007595	0.696	lactation
GO:0032570	0.688	response to progesterone
GO:0046661	0.680	male sex differentiation
GO:0021537	0.678	telencephalon development
GO:0046546	0.667	development of primary male sexual characteristics
GO:0071310	0.646	cellular response to organic substance
GO:0021854	0.641	hypothalamus development
GO:0071704	0.640	organic substance metabolic process
GO:0021543	0.639	pallium development
GO:0045924	0.626	regulation of female receptivity
GO:0060179	0.600	male mating behavior
GO:0021987	0.600	cerebral cortex development
GO:0044238	0.593	primary metabolic process
GO:0061458	0.593	reproductive system development
GO:0032870	0.545	cellular response to hormone stimulus
GO:0008406	0.528	gonad development
GO:0008584	0.500	male gonad development
GO:0044237	0.492	cellular metabolic process
GO:0032526	0.471	response to retinoic acid
GO:0022037	0.459	metencephalon development
GO:0006807	0.444	nitrogen compound metabolic process
GO:0042698	0.407	ovulation cycle
GO:0021766	0.402	hippocampus development
GO:0043170	0.364	macromolecule metabolic process
GO:0007154	0.349	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.997	nucleoplasm
GO:0032991	0.961	protein-containing complex
GO:0005829	0.955	cytosol
GO:0005667	0.798	transcription regulator complex
GO:0043232	0.793	intracellular non-membrane-bounded organelle
GO:0016020	0.788	membrane
GO:0140513	0.727	nuclear protein-containing complex
GO:0090575	0.499	RNA polymerase II transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]