StarFunc result for job id Q15796

User Input

>input (467 residues)
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9I9P9	0.900	0.898	8.189E-92	468	0.953	0.951	Q9I9P9.pdb.gz	SMAD2_DANRE Mothers against decapentaplegic homolog 2 OS=Danio rerio OX=7955 GN=smad2 PE=2 SV=1
2	AFDB:P84023	0.832	0.910	1.207E-81	426	0.835	0.915	P84023.pdb.gz	SMAD3_CHICK Mothers against decapentaplegic homolog 3 OS=Gallus gallus OX=9031 GN=SMAD3 PE=2 SV=1
3	AFDB:O96660	0.533	0.517	4.205E-61	486	0.627	0.603	O96660.pdb.gz	O96660_DROME Mothers against decapentaplegic homolog OS=Drosophila melanogaster OX=7227 GN=Smox PE=1 SV=1
4	AFDB:P97454	0.741	0.744	7.150E-61	465	0.612	0.615	P97454.pdb.gz	SMAD5_MOUSE Mothers against decapentaplegic homolog 5 OS=Mus musculus OX=10090 GN=Smad5 PE=1 SV=2
5	AFDB:P42003	0.730	0.748	2.945E-60	455	0.593	0.609	P42003.pdb.gz	MAD_DROME Protein mothers against dpp OS=Drosophila melanogaster OX=7227 GN=Mad PE=1 SV=1
6	AFDB:Q9I8V2	0.713	0.705	1.213E-59	472	0.600	0.593	Q9I8V2.pdb.gz	SMAD1_DANRE Mothers against decapentaplegic homolog 1 OS=Danio rerio OX=7955 GN=smad1 PE=2 SV=1
7	AFDB:B2GS20	0.749	0.751	1.535E-59	466	0.595	0.597	B2GS20.pdb.gz
8	AFDB:F1P4N1	0.729	0.716	1.944E-59	476	0.595	0.584	F1P4N1.pdb.gz
9	AFDB:O54835	0.689	0.738	5.298E-59	434	0.604	0.650	O54835.pdb.gz	SMAD9_RAT Mothers against decapentaplegic homolog 9 OS=Rattus norvegicus OX=10116 GN=Smad9 PE=1 SV=1
10	AFDB:P97588	0.716	0.715	8.986E-58	468	0.602	0.600	P97588.pdb.gz	SMAD1_RAT Mothers against decapentaplegic homolog 1 OS=Rattus norvegicus OX=10116 GN=Smad1 PE=2 SV=1
11	PDB:2kb3A	0.144	0.378	1.659E-1	143	0.054	0.175	2kb3A.pdb.gz
12	PDB:7dvqX	0.182	0.480	2.363E-1	156	0.026	0.077	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
13	PDB:3vehB	0.069	0.071	2.820E-1	451	0.064	0.067	3vehB.pdb.gz	Implications of binding mode and active site flexibility for inhibitor potency against the salicylate synthase from Mycobacterium tuberculosis.
14	PDB:5xqiC	0.129	0.208	2.992E-1	254	0.036	0.067	5xqiC.pdb.gz
15	PDB:2ff4A	0.118	0.143	4.262E-1	379	0.021	0.026	2ff4A.pdb.gz	Molecular structure of EmbR, a response element of Ser/Thr kinase signaling in Mycobacterium tuberculosis.
16	PDB:6z4eA	0.094	0.191	4.262E-1	207	0.026	0.058	6z4eA.pdb.gz
17	PDB:7ea3J	0.071	0.044	6.440E-1	883	0.030	0.016	7ea3J.pdb.gz
18	PDB:5dfkA	0.083	0.169	1.032	185	0.017	0.043	5dfkA.pdb.gz
19	PDB:4hk1A	0.078	0.119	1.095	243	0.047	0.091	4hk1A.pdb.gz
20	PDB:7u05A	0.071	0.037	1.307	1114	0.036	0.015	7u05A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	F1QXZ9	523	466	0.610	0.612	F1QXZ9_DANRE Mothers against decapentaplegic homolog OS=Danio rerio OX=7955 GN=sma8 PE=3 SV=1
2	O70436	970	467	0.994	0.994	SMAD2_RAT Mothers against decapentaplegic homolog 2 OS=Rattus norvegicus OX=10116 GN=Smad2 PE=1 SV=1
3	P42003	521	455	0.606	0.622	MAD_DROME Protein mothers against dpp OS=Drosophila melanogaster OX=7227 GN=Mad PE=1 SV=1
4	P70340	518	465	0.608	0.611	SMAD1_MOUSE Mothers against decapentaplegic homolog 1 OS=Mus musculus OX=10090 GN=Smad1 PE=1 SV=2
5	P84022	782	425	0.839	0.922	SMAD3_HUMAN Mothers against decapentaplegic homolog 3 OS=Homo sapiens OX=9606 GN=SMAD3 PE=1 SV=1
6	P84023	789	426	0.844	0.925	SMAD3_CHICK Mothers against decapentaplegic homolog 3 OS=Gallus gallus OX=9031 GN=SMAD3 PE=2 SV=1
7	P84025	782	425	0.839	0.922	SMAD3_RAT Mothers against decapentaplegic homolog 3 OS=Rattus norvegicus OX=10116 GN=Smad3 PE=1 SV=1
8	P97454	529	465	0.615	0.617	SMAD5_MOUSE Mothers against decapentaplegic homolog 5 OS=Mus musculus OX=10090 GN=Smad5 PE=1 SV=2
9	P97588	518	468	0.608	0.607	SMAD1_RAT Mothers against decapentaplegic homolog 1 OS=Rattus norvegicus OX=10116 GN=Smad1 PE=2 SV=1
10	Q15796	974	467	1.000	1.000	SMAD2_HUMAN Mothers against decapentaplegic homolog 2 OS=Homo sapiens OX=9606 GN=SMAD2 PE=1 SV=1
11	Q15797	519	465	0.615	0.617	SMAD1_HUMAN Mothers against decapentaplegic homolog 1 OS=Homo sapiens OX=9606 GN=SMAD1 PE=1 SV=1
12	Q56I99	530	465	0.615	0.617	SMAD5_CHICK Mothers against decapentaplegic homolog 5 OS=Gallus gallus OX=9031 GN=SMAD5 PE=1 SV=1
13	Q56IA0	522	465	0.604	0.606	Q56IA0_CHICK Mothers against decapentaplegic homolog OS=Gallus gallus OX=9031 GN=SMAD1 PE=1 SV=1
14	Q62432	972	467	0.996	0.996	SMAD2_MOUSE Mothers against decapentaplegic homolog 2 OS=Mus musculus OX=10090 GN=Smad2 PE=1 SV=2
15	Q68DB7	526	465	0.612	0.615	Q68DB7_HUMAN Mothers against decapentaplegic homolog OS=Homo sapiens OX=9606 GN=DKFZp781O1323 PE=2 SV=1
16	Q6IRR4	961	467	0.983	0.983	Q6IRR4_XENLA Mothers against decapentaplegic homolog OS=Xenopus laevis OX=8355 GN=smad2.S PE=2 SV=1
17	Q8AY15	779	425	0.837	0.920	Q8AY15_DANRE Mothers against decapentaplegic homolog OS=Danio rerio OX=7955 GN=madh3 PE=2 SV=1
18	Q8AY16	752	423	0.814	0.898	Q8AY16_DANRE Mothers against decapentaplegic homolog OS=Danio rerio OX=7955 GN=zgc:92234 PE=2 SV=1
19	Q8BUN5	782	425	0.839	0.922	SMAD3_MOUSE Mothers against decapentaplegic homolog 3 OS=Mus musculus OX=10090 GN=Smad3 PE=1 SV=2
20	Q8UWF3	970	467	0.994	0.994	Q8UWF3_CHICK Mothers against decapentaplegic homolog OS=Gallus gallus OX=9031 GN=MADH2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10401 IRF-3	47	15.2	Interferon-regulatory factor 3
2	PF03165 MH1	1.4e-39	145.8	MH1 domain
3	PF03166 MH2	7e-71	249.5	MH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9668.ENSMPUP00000000846

Rank	PPI partner	STRING score	Description
1	9668.ENSMPUP00000006895	0.998	Zinc finger, FYVE domain containing 9
2	9668.ENSMPUP00000008705	0.995	Mothers against decapentaplegic homolog
3	9668.ENSMPUP00000006078	0.994	Forkhead box H1
4	9668.ENSMPUP00000006622	0.992	Receptor protein serine/threonine kinase
5	9668.ENSMPUP00000005374	0.985	Tripartite motif containing 33
6	9668.ENSMPUP00000007150	0.985	Yes-associated protein 1
7	9668.ENSMPUP00000017001	0.982	SKI-like proto-oncogene
8	9668.ENSMPUP00000007711	0.980	SKI proto-oncogene
9	9668.ENSMPUP00000014925	0.980	CREB binding protein
10	9668.ENSMPUP00000004964	0.977	TGFB-induced factor homeobox 1
11	9668.ENSMPUP00000007701	0.977	Receptor protein serine/threonine kinase
12	9668.ENSMPUP00000009773	0.973	Forkhead box O3
13	9668.ENSMPUP00000000459	0.972	Serine/threonine-protein kinase receptor
14	9668.ENSMPUP00000008945	0.969	Cellular tumor antigen p53
15	9668.ENSMPUP00000000456	0.964	Receptor protein serine/threonine kinase
16	9668.ENSMPUP00000016323	0.962	E1A binding protein p300
17	9668.ENSMPUP00000002491	0.961	Uncharacterized protein
18	9668.ENSMPUP00000016370	0.961	Neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase
19	9668.ENSMPUP00000002076	0.960	Serine/threonine-protein kinase receptor
20	9668.ENSMPUP00000008777	0.960	Bone morphogenetic protein receptor, type IA

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.995	DNA binding
GO:0003690	0.942	double-stranded DNA binding
GO:0000976	0.929	transcription cis-regulatory region binding
GO:0140110	0.856	transcription regulator activity
GO:0003700	0.836	DNA-binding transcription factor activity
GO:0000977	0.799	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.784	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.778	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.766	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0019899	0.460	enzyme binding
GO:0008134	0.365	transcription factor binding
GO:0042802	0.350	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0019222	0.997	regulation of metabolic process
GO:0031323	0.991	regulation of cellular metabolic process
GO:0048518	0.990	positive regulation of biological process
GO:0051716	0.988	cellular response to stimulus
GO:0010468	0.987	regulation of gene expression
GO:0051171	0.985	regulation of nitrogen compound metabolic process
GO:0019219	0.978	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.976	regulation of cellular biosynthetic process
GO:0010556	0.975	regulation of macromolecule biosynthetic process
GO:0071363	0.970	cellular response to growth factor stimulus
GO:0051252	0.966	regulation of RNA metabolic process
GO:0007154	0.964	cell communication
GO:0048522	0.964	positive regulation of cellular process
GO:0032502	0.963	developmental process
GO:0032501	0.963	multicellular organismal process
GO:0048519	0.962	negative regulation of biological process
GO:2001141	0.962	regulation of RNA biosynthetic process
GO:0023052	0.958	signaling
GO:0048856	0.951	anatomical structure development
GO:0007179	0.951	transforming growth factor beta receptor signaling pathway
GO:0009893	0.948	positive regulation of metabolic process
GO:0048523	0.937	negative regulation of cellular process
GO:1903506	0.936	regulation of nucleic acid-templated transcription
GO:0006355	0.934	regulation of DNA-templated transcription
GO:0007275	0.933	multicellular organism development
GO:0009892	0.884	negative regulation of metabolic process
GO:0031325	0.878	positive regulation of cellular metabolic process
GO:0010604	0.874	positive regulation of macromolecule metabolic process
GO:0051173	0.868	positive regulation of nitrogen compound metabolic process
GO:0050793	0.822	regulation of developmental process
GO:0048583	0.771	regulation of response to stimulus
GO:0006357	0.746	regulation of transcription by RNA polymerase II
GO:0031324	0.738	negative regulation of cellular metabolic process
GO:0010605	0.725	negative regulation of macromolecule metabolic process
GO:0051239	0.711	regulation of multicellular organismal process
GO:0045935	0.705	positive regulation of nucleobase-containing compound metabolic process
GO:0023051	0.683	regulation of signaling
GO:0010646	0.683	regulation of cell communication
GO:0051254	0.675	positive regulation of RNA metabolic process
GO:0045893	0.671	positive regulation of DNA-templated transcription
GO:0008152	0.634	metabolic process
GO:0071704	0.579	organic substance metabolic process
GO:0044237	0.571	cellular metabolic process
GO:0044238	0.557	primary metabolic process
GO:0009966	0.544	regulation of signal transduction
GO:0045944	0.532	positive regulation of transcription by RNA polymerase II
GO:0006807	0.526	nitrogen compound metabolic process
GO:0048513	0.504	animal organ development
GO:0051172	0.485	negative regulation of nitrogen compound metabolic process
GO:0043170	0.475	macromolecule metabolic process
GO:0048731	0.463	system development
GO:0051094	0.460	positive regulation of developmental process
GO:0007389	0.450	pattern specification process
GO:0030154	0.438	cell differentiation
GO:0045595	0.424	regulation of cell differentiation
GO:0045892	0.407	negative regulation of DNA-templated transcription
GO:0042221	0.381	response to chemical
GO:0042127	0.318	regulation of cell population proliferation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0005829	0.993	cytosol
GO:0032991	0.990	protein-containing complex
GO:0043232	0.907	intracellular non-membrane-bounded organelle
GO:0031982	0.638	vesicle
GO:0005667	0.636	transcription regulator complex
GO:0140513	0.375	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]