StarFunc result for job id Q15797

User Input

>input (465 residues)
MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQ
PSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEV
CINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPN
SHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQ
PMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
DPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC
NYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGW
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97588	0.859	0.853	7.261E-92	468	0.978	0.972	P97588.pdb.gz	SMAD1_RAT Mothers against decapentaplegic homolog 1 OS=Rattus norvegicus OX=10116 GN=Smad1 PE=2 SV=1
2	AFDB:P97454	0.933	0.933	9.249E-87	465	0.892	0.892	P97454.pdb.gz	SMAD5_MOUSE Mothers against decapentaplegic homolog 5 OS=Mus musculus OX=10090 GN=Smad5 PE=1 SV=2
3	AFDB:Q9I8V2	0.810	0.798	1.846E-83	472	0.899	0.886	Q9I8V2.pdb.gz	SMAD1_DANRE Mothers against decapentaplegic homolog 1 OS=Danio rerio OX=7955 GN=smad1 PE=2 SV=1
4	AFDB:F1P4N1	0.847	0.828	7.875E-81	476	0.811	0.792	F1P4N1.pdb.gz
5	AFDB:B2GS20	0.814	0.812	5.264E-80	466	0.802	0.800	B2GS20.pdb.gz
6	AFDB:P42003	0.791	0.808	1.414E-76	455	0.735	0.752	P42003.pdb.gz	MAD_DROME Protein mothers against dpp OS=Drosophila melanogaster OX=7227 GN=Mad PE=1 SV=1
7	AFDB:O54835	0.758	0.808	6.238E-76	434	0.776	0.832	O54835.pdb.gz	SMAD9_RAT Mothers against decapentaplegic homolog 9 OS=Rattus norvegicus OX=10116 GN=Smad9 PE=1 SV=1
8	AFDB:P84023	0.757	0.824	6.457E-64	426	0.604	0.660	P84023.pdb.gz	SMAD3_CHICK Mothers against decapentaplegic homolog 3 OS=Gallus gallus OX=9031 GN=SMAD3 PE=2 SV=1
9	AFDB:Q9I9P9	0.759	0.754	8.399E-62	468	0.606	0.603	Q9I9P9.pdb.gz	SMAD2_DANRE Mothers against decapentaplegic homolog 2 OS=Danio rerio OX=7955 GN=smad2 PE=2 SV=1
10	AFDB:Q02330	0.434	0.482	1.649E-50	418	0.508	0.565	Q02330.pdb.gz	SMA2_CAEEL Dwarfin sma-2 OS=Caenorhabditis elegans OX=6239 GN=sma-2 PE=2 SV=2
11	PDB:7dvqX	0.183	0.486	8.264E-2	156	0.032	0.096	7dvqX.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:3vehB	0.062	0.064	7.433E-1	451	0.054	0.055	3vehB.pdb.gz	Implications of binding mode and active site flexibility for inhibitor potency against the salicylate synthase from Mycobacterium tuberculosis.
13	PDB:4hk1A	0.077	0.119	7.888E-1	243	0.056	0.107	4hk1A.pdb.gz
14	PDB:6e5bH	0.061	0.094	1.061	218	0.037	0.078	6e5bH.pdb.gz	Design and Evaluation of Highly Selective Human Immunoproteasome Inhibitors Reveal a Compensatory Process That Preserves Immune Cell Viability.
15	PDB:2kb3A	0.140	0.380	1.346	143	0.032	0.105	2kb3A.pdb.gz
16	PDB:5fxtA	0.067	0.075	1.346	374	0.047	0.059	5fxtA.pdb.gz	Screening of E. coli beta-clamp Inhibitors Revealed that Few Inhibit Helicobacter pylori More Effectively: Structural and Functional Characterization.
17	PDB:6jkvA	0.073	0.126	1.428	230	0.037	0.074	6jkvA.pdb.gz	Crystal structure of PppA from Pseudomonas aeruginosa, a key regulatory component of type VI secretion systems.
18	PDB:5y6fA	0.070	0.115	1.516	226	0.030	0.062	5y6fA.pdb.gz	Structural insights into the mechanism of c-di-GMP-bound YcgR regulating flagellar motility inEscherichia coli.
19	PDB:6uzyA	0.064	0.091	1.608	278	0.019	0.032	6uzyA.pdb.gz	Cryo-EM structures of the ATP release channel pannexin 1.
20	PDB:7ea3J	0.088	0.053	1.707	883	0.034	0.018	7ea3J.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	F1QXZ9	739	466	0.802	0.800	F1QXZ9_DANRE Mothers against decapentaplegic homolog OS=Danio rerio OX=7955 GN=sma8 PE=3 SV=1
2	O15198	753	467	0.815	0.812	SMAD9_HUMAN Mothers against decapentaplegic homolog 9 OS=Homo sapiens OX=9606 GN=SMAD9 PE=1 SV=1
3	O54835	686	434	0.776	0.832	SMAD9_RAT Mothers against decapentaplegic homolog 9 OS=Rattus norvegicus OX=10116 GN=Smad9 PE=1 SV=1
4	P42003	697	455	0.753	0.769	MAD_DROME Protein mothers against dpp OS=Drosophila melanogaster OX=7227 GN=Mad PE=1 SV=1
5	P70340	963	465	0.991	0.991	SMAD1_MOUSE Mothers against decapentaplegic homolog 1 OS=Mus musculus OX=10090 GN=Smad1 PE=1 SV=2
6	P84022	529	425	0.613	0.671	SMAD3_HUMAN Mothers against decapentaplegic homolog 3 OS=Homo sapiens OX=9606 GN=SMAD3 PE=1 SV=1
7	P84023	529	426	0.606	0.662	SMAD3_CHICK Mothers against decapentaplegic homolog 3 OS=Gallus gallus OX=9031 GN=SMAD3 PE=2 SV=1
8	P84025	529	425	0.613	0.671	SMAD3_RAT Mothers against decapentaplegic homolog 3 OS=Rattus norvegicus OX=10116 GN=Smad3 PE=1 SV=1
9	P97454	817	465	0.882	0.882	SMAD5_MOUSE Mothers against decapentaplegic homolog 5 OS=Mus musculus OX=10090 GN=Smad5 PE=1 SV=2
10	P97588	944	468	0.978	0.972	SMAD1_RAT Mothers against decapentaplegic homolog 1 OS=Rattus norvegicus OX=10116 GN=Smad1 PE=2 SV=1
11	Q15797	970	465	1.000	1.000	SMAD1_HUMAN Mothers against decapentaplegic homolog 1 OS=Homo sapiens OX=9606 GN=SMAD1 PE=1 SV=1
12	Q56I98	723	476	0.815	0.796	Q56I98_CHICK Mothers against decapentaplegic homolog OS=Gallus gallus OX=9031 GN=SMAD8 PE=2 SV=1
13	Q56I99	807	465	0.892	0.892	SMAD5_CHICK Mothers against decapentaplegic homolog 5 OS=Gallus gallus OX=9031 GN=SMAD5 PE=1 SV=1
14	Q56IA0	942	465	0.972	0.972	Q56IA0_CHICK Mothers against decapentaplegic homolog OS=Gallus gallus OX=9031 GN=SMAD1 PE=1 SV=1
15	Q68DB7	820	465	0.882	0.882	Q68DB7_HUMAN Mothers against decapentaplegic homolog OS=Homo sapiens OX=9606 GN=DKFZp781O1323 PE=2 SV=1
16	Q8AY15	528	425	0.615	0.673	Q8AY15_DANRE Mothers against decapentaplegic homolog OS=Danio rerio OX=7955 GN=madh3 PE=2 SV=1
17	Q8AY16	520	423	0.598	0.657	Q8AY16_DANRE Mothers against decapentaplegic homolog OS=Danio rerio OX=7955 GN=zgc:92234 PE=2 SV=1
18	Q8BUN5	529	425	0.613	0.671	SMAD3_MOUSE Mothers against decapentaplegic homolog 3 OS=Mus musculus OX=10090 GN=Smad3 PE=1 SV=2
19	Q99717	820	465	0.882	0.882	SMAD5_HUMAN Mothers against decapentaplegic homolog 5 OS=Homo sapiens OX=9606 GN=SMAD5 PE=1 SV=1
20	Q9I8V2	803	472	0.899	0.886	SMAD1_DANRE Mothers against decapentaplegic homolog 1 OS=Danio rerio OX=7955 GN=smad1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13978 DUF4223	1.4e+02	13.8	Protein of unknown function (DUF4223)
2	PF10401 IRF-3	1.6	20.0	Interferon-regulatory factor 3
3	PF03165 MH1	7.9e-39	143.4	MH1 domain
4	PF03166 MH2	1e-67	239.2	MH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010359582.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010375088.1	0.995	SMAD family member 4
2	61622.XP_010377339.1	0.991	Yes associated protein 1
3	61622.XP_010351652.1	0.988	Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
4	61622.XP_010361974.1	0.987	SMAD family member 6
5	61622.XP_010378782.1	0.987	Bone morphogenetic protein receptor type-1A isoform X1
6	61622.XP_010374062.1	0.986	SMAD specific E3 ubiquitin protein ligase 1
7	61622.XP_010383884.1	0.980	Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family. TGFB receptor subfamily.
8	61622.XP_010380076.1	0.976	Mitogen-activated protein kinase 1
9	61622.XP_010370838.1	0.968	Forms the heterodimeric complex core-binding factor (CBF) with CBFB. RUNX members modulate the transcription of their target genes through recognizing the core consensus binding sequence 5'- TGTGGT-3', or very rarely, 5'-TGCGGT-3', within their regulatory regions via their runt domain, while CBFB is a non-DNA-binding regulatory subunit that allosterically enhances the sequence-specific DNA-binding capacity of RUNX
10	61622.XP_010385672.1	0.968	Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. MAP kinase subfamily
11	61622.XP_010378393.1	0.959	E3 ubiquitin-protein ligase SMURF2
12	61622.XP_010358500.1	0.958	SMAD family member 7
13	61622.XP_010361911.1	0.929	SMAD family member 3
14	61622.XP_010355928.1	0.926	Belongs to the protein kinase superfamily.
15	61622.XP_010358201.1	0.924	SMAD family member 5
16	61622.XP_010372299.1	0.912	Activin A receptor like type 1
17	61622.XP_010350903.1	0.908	Ski oncogene
18	61622.XP_010370358.1	0.903	Bone morphogenetic protein 4
19	61622.XP_010386077.1	0.892	Bone morphogenetic protein 2
20	61622.XP_010374337.1	0.886	CREB binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0000976	0.985	transcription cis-regulatory region binding
GO:0000977	0.903	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.887	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.882	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0140110	0.873	transcription regulator activity
GO:0003700	0.854	DNA-binding transcription factor activity
GO:0000981	0.829	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.995	signal transduction
GO:0048856	0.994	anatomical structure development
GO:0048518	0.986	positive regulation of biological process
GO:0080090	0.985	regulation of primary metabolic process
GO:0051171	0.985	regulation of nitrogen compound metabolic process
GO:0010468	0.985	regulation of gene expression
GO:0007167	0.985	enzyme-linked receptor protein signaling pathway
GO:0070848	0.984	response to growth factor
GO:0007275	0.983	multicellular organism development
GO:0007178	0.983	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:1903506	0.981	regulation of nucleic acid-templated transcription
GO:0048519	0.978	negative regulation of biological process
GO:0071773	0.971	cellular response to BMP stimulus
GO:0048523	0.965	negative regulation of cellular process
GO:0006355	0.963	regulation of DNA-templated transcription
GO:0030509	0.949	BMP signaling pathway
GO:0048522	0.948	positive regulation of cellular process
GO:0045893	0.929	positive regulation of DNA-templated transcription
GO:0006357	0.869	regulation of transcription by RNA polymerase II
GO:0009892	0.866	negative regulation of metabolic process
GO:0050793	0.857	regulation of developmental process
GO:0010605	0.854	negative regulation of macromolecule metabolic process
GO:0048869	0.850	cellular developmental process
GO:0008152	0.718	metabolic process
GO:0030154	0.714	cell differentiation
GO:0071704	0.674	organic substance metabolic process
GO:0045944	0.617	positive regulation of transcription by RNA polymerase II
GO:0044238	0.601	primary metabolic process
GO:0048583	0.592	regulation of response to stimulus
GO:0031324	0.582	negative regulation of cellular metabolic process
GO:0006807	0.577	nitrogen compound metabolic process
GO:0043170	0.575	macromolecule metabolic process
GO:0048513	0.567	animal organ development
GO:0044237	0.550	cellular metabolic process
GO:0010646	0.550	regulation of cell communication
GO:0051094	0.549	positive regulation of developmental process
GO:0023051	0.548	regulation of signaling
GO:0051172	0.501	negative regulation of nitrogen compound metabolic process
GO:0048731	0.500	system development
GO:0009966	0.487	regulation of signal transduction
GO:0051253	0.487	negative regulation of RNA metabolic process
GO:0045595	0.484	regulation of cell differentiation
GO:0010558	0.482	negative regulation of macromolecule biosynthetic process
GO:0031327	0.477	negative regulation of cellular biosynthetic process
GO:0045892	0.471	negative regulation of DNA-templated transcription
GO:0051239	0.466	regulation of multicellular organismal process
GO:0035556	0.463	intracellular signal transduction
GO:0045597	0.405	positive regulation of cell differentiation
GO:1901564	0.358	organonitrogen compound metabolic process
GO:0019538	0.354	protein metabolic process
GO:0036211	0.340	protein modification process
GO:0042127	0.334	regulation of cell population proliferation
GO:0060395	0.324	SMAD protein signal transduction
GO:0071560	0.323	cellular response to transforming growth factor beta stimulus
GO:0042221	0.321	response to chemical
GO:0009888	0.317	tissue development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.998	cytoplasm
GO:0005654	0.980	nucleoplasm
GO:0032991	0.962	protein-containing complex
GO:0005829	0.945	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]