StarFunc result for job id Q15811

User Input

>input (1721 residues)
MAQFPTPFGGSLDIWAITVEERAKHDQQFHSLKPISGFITGDQARNFFFQSGLPQPVLAQ
IWALADMNNDGRMDQVEFSIAMKLIKLKLQGYQLPSALPPVMKQQPVAISSAPAFGMGGI
ASMPPLTAVAPVPMGSIPVVGMSPTLVSSVPTAAVPPLANGAPPVIQPLPAFAHPAATLP
KSSSFSRSGPGSQLNTKLQKAQSFDVASVPPVAEWAVPQSSRLKYRQLFNSHDKTMSGHL
TGPQARTILMQSSLPQAQLASIWNLSDIDQDGKLTAEEFILAMHLIDVAMSGQPLPPVLP
PEYIPPSFRRVRSGSGISVISSTSVDQRLPEEPVLEDEQQQLEKKLPVTFEDKKRENFER
GNLELEKRRQALLEQQRKEQERLAQLERAEQERKERERQEQERKRQLELEKQLEKQRELE
RQREEERRKEIERREAAKRELERQRQLEWERNRRQELLNQRNKEQEDIVVLKAKKKTLEF
ELEALNDKKHQLEGKLQDIRCRLTTQRQEIESTNKSRELRIAEITHLQQQLQESQQMLGR
LIPEKQILNDQLKQVQQNSLHRDSLVTLKRALEAKELARQHLRDQLDEVEKETRSKLQEI
DIFNNQLKELREIHNKQQLQKQKSMEAERLKQKEQERKIIELEKQKEEAQRRAQERDKQW
LEHVQQEDEHQRPRKLHEEEKLKREESVKKKDGEEKGKQEAQDKLGRLFHQHQEPAKPAV
QAPWSTAEKGPLTISAQENVKVVYYRALYPFESRSHDEITIQPGDIVMVKGEWVDESQTG
EPGWLGGELKGKTGWFPANYAEKIPENEVPAPVKPVTDSTSAPAPKLALRETPAPLAVTS
SEPSTTPNNWADFSSTWPTSTNEKPETDNWDAWAAQPSLTVPSAGQLRQRSAFTPATATG
SSPSPVLGQGEKVEGLQAQALYPWRAKKDNHLNFNKNDVITVLEQQDMWWFGEVQGQKGW
FPKSYVKLISGPIRKSTSMDSGSSESPASLKRVASPAAKPVVSGEEFIAMYTYESSEQGD
LTFQQGDVILVTKKDGDWWTGTVGDKAGVFPSNYVRLKDSEGSGTAGKTGSLGKKPEIAQ
VIASYTATGPEQLTLAPGQLILIRKKNPGGWWEGELQARGKKRQIGWFPANYVKLLSPGT
SKITPTEPPKSTALAAVCQVIGMYDYTAQNDDELAFNKGQIINVLNKEDPDWWKGEVNGQ
VGLFPSNYVKLTTDMDPSQQWCSDLHLLDMLTPTERKRQGYIHELIVTEENYVNDLQLVT
EIFQKPLMESELLTEKEVAMIFVNWKELIMCNIKLLKALRVRKKMSGEKMPVKMIGDILS
AQLPHMQPYIRFCSRQLNGAALIQQKTDEAPDFKEFVKRLAMDPRCKGMPLSSFILKPMQ
RVTRYPLIIKNILENTPENHPDHSHLKHALEKAEELCSQVNEGVREKENSDRLEWIQAHV
QCEGLSEQLVFNSVTNCLGPRKFLHSGKLYKAKSNKELYGFLFNDFLLLTQITKPLGSSG
TDKVFSPKSNLQYKMYKTPIFLNEVLVKLPTDPSGDEPIFHISHIDRVYTLRAESINERT
AWVQKIKAASELYIETEKKKREKAYLVRSQRATGIGRLMVNVVEGIELKPCRSHGKSNPY
CEVTMGSQCHITKTIQDTLNPKWNSNCQFFIRDLEQEVLCITVFERDQFSPDDFLGRTEI
RVADIKKDQGSKGPVTKCLLLHEVPTGEIVVRLDLQLFDEP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15811	1.000	1.000	0.000	1721	1.000	1.000	Q15811.pdb.gz	ITSN1_HUMAN Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=3
2	AFDB:Q9NZM3	0.407	0.413	0.000	1697	0.601	0.610	Q9NZM3.pdb.gz	ITSN2_HUMAN Intersectin-2 OS=Homo sapiens OX=9606 GN=ITSN2 PE=1 SV=3
3	AFDB:Q9Z0R6	0.421	0.436	0.000	1659	0.588	0.610	Q9Z0R6.pdb.gz	ITSN2_MOUSE Intersectin-2 OS=Mus musculus OX=10090 GN=Itsn2 PE=1 SV=2
4	AFDB:M9ND00	0.084	0.107	2.349E-63	1190	0.228	0.330	M9ND00.pdb.gz	M9ND00_DROME Dynamin associated protein 160, isoform D OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
5	AFDB:Q8INU2	0.087	0.133	5.708E-63	1014	0.230	0.391	Q8INU2.pdb.gz	Q8INU2_DROME Dynamin associated protein 160, isoform B OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
6	AFDB:Q9U2T9	0.102	0.149	7.656E-60	1085	0.197	0.312	Q9U2T9.pdb.gz	Q9U2T9_CAEEL Intersectin-1 OS=Caenorhabditis elegans OX=6239 GN=itsn-1 PE=1 SV=2
7	PDB:4mt6A	0.151	0.510	8.762E-21	389	0.049	0.219	4mt6A.pdb.gz
8	AFDB:Q9NZN5	0.180	0.200	2.126E-19	1544	0.084	0.094	Q9NZN5.pdb.gz	ARHGC_HUMAN Rho guanine nucleotide exchange factor 12 OS=Homo sapiens OX=9606 GN=ARHGEF12 PE=1 SV=1
9	AFDB:G5ECK4	0.106	0.119	1.083E-18	1523	0.054	0.061	G5ECK4.pdb.gz	G5ECK4_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnbp-1 PE=1 SV=1
10	AFDB:Q96PE2	0.149	0.128	1.138E-18	2063	0.099	0.082	Q96PE2.pdb.gz	ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1
11	AFDB:E9Q7D5	0.177	0.192	5.601E-17	1581	0.094	0.102	E9Q7D5.pdb.gz	ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus OX=10090 GN=Arhgef5 PE=1 SV=1
12	PDB:7rx9A	0.107	0.407	8.586E-16	432	0.046	0.183	7rx9A.pdb.gz
13	PDB:4gouA	0.108	0.314	6.051E-10	507	0.033	0.110	4gouA.pdb.gz
14	PDB:5a50A	0.069	0.657	1.705E-9	165	0.022	0.230	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
15	PDB:4rj9A	0.068	0.641	2.182E-9	161	0.023	0.242	4rj9A.pdb.gz
16	PDB:5a52A	0.068	0.709	1.226E-8	154	0.019	0.214	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
17	PDB:1griA	0.045	0.261	2.328E-8	211	0.030	0.242	1griA.pdb.gz
18	PDB:2lqnA	0.036	0.186	7.990E-8	303	0.027	0.155	2lqnA.pdb.gz
19	PDB:5iz5A	0.067	0.150	9.265E-8	757	0.015	0.034	5iz5A.pdb.gz
20	PDB:5ixcA	0.067	0.166	1.444E-7	684	0.015	0.038	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F8W7U0	0.0	1979	1149	0.615	0.921	F8W7U0_HUMAN Intersectin 1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=1
2	Q15811	0.0	3543	1721	1.000	1.000	ITSN1_HUMAN Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=3
3	Q6GMY7	0.0	1292	648	0.375	0.995	Q6GMY7_HUMAN ITSN1 protein (Fragment) OS=Homo sapiens OX=9606 GN=ITSN1 PE=2 SV=1
4	Q9NZM3	0.0	1919	1697	0.609	0.618	ITSN2_HUMAN Intersectin-2 OS=Homo sapiens OX=9606 GN=ITSN2 PE=1 SV=3
5	Q9WVE9	0.0	3197	1713	0.940	0.944	ITSN1_RAT Intersectin-1 OS=Rattus norvegicus OX=10116 GN=Itsn1 PE=1 SV=2
6	Q9Z0R4	0.0	3258	1714	0.947	0.951	ITSN1_MOUSE Intersectin-1 OS=Mus musculus OX=10090 GN=Itsn1 PE=1 SV=2
7	Q9Z0R6	0.0	1874	1659	0.599	0.621	ITSN2_MOUSE Intersectin-2 OS=Mus musculus OX=10090 GN=Itsn2 PE=1 SV=2
8	M9PDC7	1.30e-134	447	1005	0.202	0.345	M9PDC7_DROME Dynamin associated protein 160, isoform H OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
9	Q8INU2	2.48e-134	447	1014	0.202	0.342	Q8INU2_DROME Dynamin associated protein 160, isoform B OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
10	O61639	4.59e-134	446	1011	0.200	0.341	O61639_DROME Dynamin associated protein isoform Dap160-2 OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
11	M9PBF6	1.97e-111	384	1088	0.163	0.257	M9PBF6_DROME Dynamin associated protein 160, isoform G OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
12	O61618	2.41e-111	384	1094	0.163	0.256	O61618_DROME Dynamin associated protein isoform Dap160-1 OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
13	Q9VIF7	2.72e-111	384	1097	0.163	0.255	Q9VIF7_DROME Dynamin associated protein 160, isoform A OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
14	Q1WWC9	2.80e-111	384	1096	0.163	0.255	Q1WWC9_DROME Dynamin associated protein 160, isoform C OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
15	M9ND00	7.74e-109	379	1190	0.161	0.233	M9ND00_DROME Dynamin associated protein 160, isoform D OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
16	Q9U2T9	1.66e-59	227	1085	0.134	0.212	Q9U2T9_CAEEL Intersectin-1 OS=Caenorhabditis elegans OX=6239 GN=itsn-1 PE=1 SV=2
17	Q8T068	2.17e-49	190	662	0.067	0.174	Q8T068_DROME LD23686p OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
18	E6N0W0	4.50e-45	179	825	0.063	0.131	E6N0W0_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=itsn-1 PE=1 SV=1
19	E6N0W1	7.83e-45	176	632	0.063	0.171	E6N0W1_CAEEL SH3 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=itsn-1 PE=1 SV=1
20	Q9UBC2	1.77e-39	162	864	0.087	0.174	EP15R_HUMAN Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	1e-17	75.7	C2 domain
2	PF00036 EF-hand_1	1.5e-05	35.2	EF hand
3	PF12763 EF-hand_4	3.3e-27	105.8	Cytoskeletal-regulatory complex EF hand
4	PF13202 EF-hand_5	61	14.5	EF hand
5	PF13405 EF-hand_6	0.0071	27.1	EF-hand domain
6	PF13499 EF-hand_7	0.12	24.2	EF-hand domain pair
7	PF16617 INTAP	2e-50	181.4	Intersectin and clathrin adaptor AP2 binding region
8	PF00169 PH	1.5	20.7	PH domain
9	PF16652 PH_13	7.9e-73	254.9	Pleckstrin homology domain
10	PF00621 RhoGEF	1.9e-42	157.1	RhoGEF domain
11	PF00018 SH3_1	1.9e-56	198.8	SH3 domain
12	PF07653 SH3_2	1.7e-54	192.8	Variant SH3 domain
13	PF14604 SH3_9	5.2e-60	210.5	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000370719

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000383118	0.999	Cell division control protein 42 homolog
2	9606.ENSP00000264033	0.997	E3 ubiquitin-protein ligase CBL
3	9606.ENSP00000223023	0.994	Neural Wiskott-Aldrich syndrome protein
4	9606.ENSP00000362014	0.989	Dynamin-1
5	9606.ENSP00000363763	0.984	Ephrin type-B receptor 2
6	9606.ENSP00000360798	0.982	Epidermal growth factor receptor substrate 15
7	9606.ENSP00000409667	0.978	Synaptojanin-1
8	9606.ENSP00000373905	0.976	Dynamin-2
9	9606.ENSP00000482835	0.966	AP-2 complex subunit beta
10	9606.ENSP00000365891	0.965	Wiskott-Aldrich syndrome protein
11	9606.ENSP00000473001	0.953	F-BAR domain only protein 1
12	9606.ENSP00000298316	0.948	ADP-ribosylation factor 6
13	9606.ENSP00000351926	0.935	AP-2 complex subunit alpha-1
14	9606.ENSP00000245323	0.929	Ephrin-B2
15	9606.ENSP00000204961	0.927	Ephrin-B1
16	9606.ENSP00000249647	0.926	Synaptosomal-associated protein 23
17	9606.ENSP00000327694	0.925	AP-2 complex subunit alpha-2
18	9606.ENSP00000345195	0.922	Ubiquilin-2
19	9606.ENSP00000391942	0.921	Adaptin ear-binding coat-associated protein 2
20	9606.ENSP00000347244	0.920	Intersectin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030234	0.980	enzyme regulator activity
GO:0140677	0.978	molecular function activator activity
GO:0030695	0.923	GTPase regulator activity
GO:0005085	0.757	guanyl-nucleotide exchange factor activity
GO:0070064	0.553	proline-rich region binding
GO:0060090	0.442	molecular adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0048518	0.985	positive regulation of biological process
GO:0048522	0.977	positive regulation of cellular process
GO:0051179	0.942	localization
GO:0023051	0.942	regulation of signaling
GO:0009966	0.931	regulation of signal transduction
GO:1902531	0.794	regulation of intracellular signal transduction
GO:0051641	0.645	cellular localization
GO:0051056	0.545	regulation of small GTPase mediated signal transduction
GO:0051128	0.512	regulation of cellular component organization
GO:0050896	0.497	response to stimulus
GO:0006810	0.466	transport
GO:0007154	0.419	cell communication
GO:0048519	0.417	negative regulation of biological process
GO:0023052	0.415	signaling
GO:0023056	0.405	positive regulation of signaling
GO:0051716	0.395	cellular response to stimulus
GO:0032502	0.343	developmental process
GO:0048856	0.334	anatomical structure development
GO:0032501	0.326	multicellular organismal process
GO:0048523	0.319	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005737	0.996	cytoplasm
GO:0012505	0.995	endomembrane system
GO:0005829	0.994	cytosol
GO:0098590	0.978	plasma membrane region
GO:0005905	0.962	clathrin-coated pit
GO:0031982	0.927	vesicle
GO:0030054	0.787	cell junction
GO:0097708	0.758	intracellular vesicle
GO:0005634	0.698	nucleus
GO:0043232	0.669	intracellular non-membrane-bounded organelle
GO:0120025	0.643	plasma membrane bounded cell projection
GO:0045202	0.607	synapse
GO:0031410	0.533	cytoplasmic vesicle
GO:0098793	0.497	presynapse
GO:1903561	0.404	extracellular vesicle
GO:0005615	0.367	extracellular space
GO:0043005	0.310	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]