StarFunc result for job id Q15818

User Input

>input (432 residues)
MPAGRAARTCALLALCLLGAGAQDFGPTRFICTSVPVDADMCAASVAAGGAEELRSSVLQ
LRETVLQQKETILSQKETIRELTAKLGRCESQSTLDPGAGEARAGGGRKQPGSGKNTMGD
LSRTPAAETLSQLGQTLQSLKTRLENLEQYSRLNSSSQTNSLKDLLQSKIDELERQVLSR
VNTLEEGKGGPRNDTEERVKIETALTSLHQRISELEKGQKDNRPGDKFQLTFPLRTNYMY
AKVKKSLPEMYAFTVCMWLKSSATPGVGTPFSYAVPGQANELVLIEWGNNPMEILINDKV
AKLPFVINDGKWHHICVTWTTRDGVWEAYQDGTQGGSGENLAPYHPIKPQGVLVLGQEQD
TLGGGFDATQAFVGELAHFNIWDRKLTPGEVYNLATCSTKALSGNVIAWAESHIEIYGGA
TKWTFEACRQIN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P47971	0.569	0.569	1.203E-70	432	0.958	0.958	P47971.pdb.gz	NPTX1_RAT Neuronal pentraxin-1 OS=Rattus norvegicus OX=10116 GN=Nptx1 PE=1 SV=1
2	AFDB:P97738	0.478	0.478	1.847E-48	432	0.532	0.532	P97738.pdb.gz	NPTX2_RAT Neuronal pentraxin-2 OS=Rattus norvegicus OX=10116 GN=Nptx2 PE=1 SV=1
3	AFDB:F1Q689	0.490	0.497	8.864E-48	426	0.537	0.545	F1Q689.pdb.gz
4	AFDB:Q6DG61	0.480	0.460	1.543E-46	451	0.539	0.517	Q6DG61.pdb.gz
5	AFDB:O95502	0.461	0.399	3.903E-42	500	0.486	0.420	O95502.pdb.gz	NPTXR_HUMAN Neuronal pentraxin receptor OS=Homo sapiens OX=9606 GN=NPTXR PE=3 SV=2
6	AFDB:H3BLN6	0.464	0.538	3.387E-37	372	0.356	0.414	H3BLN6.pdb.gz	H3BLN6_MOUSE Neuronal pentraxin chromo domain OS=Mus musculus OX=10090 GN=Npcd PE=4 SV=1
7	AFDB:Q6TKP2	0.464	0.299	5.302E-37	672	0.370	0.238	Q6TKP2.pdb.gz	Q6TKP2_MOUSE Neuronal pentraxin with chromo domain OS=Mus musculus OX=10090 GN=Npcd PE=2 SV=1
8	AFDB:F8VQB8	0.468	0.431	7.847E-37	469	0.368	0.339	F8VQB8.pdb.gz	F8VQB8_MOUSE Neuronal pentraxin chromo domain OS=Mus musculus OX=10090 GN=Npcd PE=4 SV=1
9	AFDB:Q5UMH8	0.415	0.414	4.048E-20	433	0.225	0.224	Q5UMH8.pdb.gz	Q5UMH8_CHICK PPTX OS=Gallus gallus OX=9031 PE=1 SV=1
10	AFDB:Q7Z7M1	0.419	0.193	3.597E-19	963	0.148	0.066	Q7Z7M1.pdb.gz	AGRD2_HUMAN Adhesion G-protein coupled receptor D2 OS=Homo sapiens OX=9606 GN=ADGRD2 PE=2 SV=1
11	PDB:1b09A	0.431	0.878	1.621E-16	206	0.127	0.267	1b09A.pdb.gz	The physiological structure of human C-reactive protein and its complex with phosphocholine.
12	PDB:7zl1A	0.416	0.808	2.028E-16	215	0.125	0.251	7zl1A.pdb.gz
13	PDB:4pbpB	0.439	0.881	8.703E-16	210	0.118	0.243	4pbpB.pdb.gz	Crystal structures for short-chain pentraxin from zebrafish demonstrate a cyclic trimer with new recognition and effector faces.
14	PDB:2a3wA	0.423	0.868	5.526E-15	204	0.123	0.260	2a3wA.pdb.gz	Ligand-assisted Aggregation of Proteins: DIMERIZATION OF SERUM AMYLOID P COMPONENT BY BIVALENT LIGANDS.
15	PDB:8a7eC	0.346	0.108	1.044E-8	1524	0.088	0.025	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
16	PDB:7ufgB	0.351	0.139	9.813E-8	1182	0.086	0.031	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
17	PDB:7ufgA	0.308	0.125	3.764E-7	1151	0.088	0.033	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
18	PDB:3v0aB	0.275	0.112	2.021E-6	1150	0.044	0.017	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
19	PDB:3ffzA	0.251	0.094	1.213E-5	1246	0.062	0.022	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.
20	PDB:5n0cA	0.258	0.093	4.160E-5	1293	0.074	0.025	5n0cA.pdb.gz	The structure of the tetanus toxin reveals pH-mediated domain dynamics.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P47971	0.0	840	432	0.958	0.958	NPTX1_RAT Neuronal pentraxin-1 OS=Rattus norvegicus OX=10116 GN=Nptx1 PE=1 SV=1
2	Q15818	0.0	894	432	1.000	1.000	NPTX1_HUMAN Neuronal pentraxin-1 OS=Homo sapiens OX=9606 GN=NPTX1 PE=1 SV=2
3	Q62443	0.0	865	432	0.963	0.963	NPTX1_MOUSE Neuronal pentraxin-1 OS=Mus musculus OX=10090 GN=Nptx1 PE=1 SV=1
4	O70340	1.64e-166	476	429	0.546	0.550	NPTX2_MOUSE Neuronal pentraxin-2 OS=Mus musculus OX=10090 GN=Nptx2 PE=2 SV=1
5	D2D0C1	9.08e-166	474	433	0.537	0.536	D2D0C1_DANRE Neuronal pentraxin 2a OS=Danio rerio OX=7955 GN=nptx2 PE=2 SV=1
6	A8E4K4	2.12e-165	473	432	0.528	0.528	A8E4K4_DANRE Neuronal pentraxin 2a precursor OS=Danio rerio OX=7955 GN=nptx2 PE=2 SV=1
7	P97738	1.22e-163	469	432	0.528	0.528	NPTX2_RAT Neuronal pentraxin-2 OS=Rattus norvegicus OX=10116 GN=Nptx2 PE=1 SV=1
8	P47972	3.90e-162	465	431	0.528	0.529	NPTX2_HUMAN Neuronal pentraxin-2 OS=Homo sapiens OX=9606 GN=NPTX2 PE=1 SV=2
9	D2D0C0	1.31e-161	464	426	0.542	0.549	D2D0C0_DANRE Neuronal pentraxin 2b OS=Danio rerio OX=7955 GN=nptx2b PE=2 SV=1
10	O35764	6.29e-130	385	494	0.463	0.405	NPTXR_RAT Neuronal pentraxin receptor OS=Rattus norvegicus OX=10116 GN=Nptxr PE=1 SV=1
11	Q99J85	1.88e-127	379	493	0.463	0.406	NPTXR_MOUSE Neuronal pentraxin receptor OS=Mus musculus OX=10090 GN=Nptxr PE=1 SV=1
12	O95502	5.85e-126	375	500	0.470	0.406	NPTXR_HUMAN Neuronal pentraxin receptor OS=Homo sapiens OX=9606 GN=NPTXR PE=3 SV=2
13	H3BLN6	9.23e-111	332	372	0.368	0.427	H3BLN6_MOUSE Neuronal pentraxin chromo domain OS=Mus musculus OX=10090 GN=Npcd PE=4 SV=1
14	F8VQB8	8.46e-110	333	469	0.354	0.326	F8VQB8_MOUSE Neuronal pentraxin chromo domain OS=Mus musculus OX=10090 GN=Npcd PE=4 SV=1
15	Q6TLW1	2.60e-108	326	372	0.363	0.422	Q6TLW1_MOUSE Neuronal pentraxin 1.1 kb variant OS=Mus musculus OX=10090 GN=Npcd PE=2 SV=1
16	Q6TLW0	2.55e-107	327	469	0.350	0.322	Q6TLW0_MOUSE Neuronal pentraxin 1.4 kb variant OS=Mus musculus OX=10090 GN=Npcd PE=2 SV=1
17	Q6TKP2	1.70e-105	328	672	0.350	0.225	Q6TKP2_MOUSE Neuronal pentraxin with chromo domain OS=Mus musculus OX=10090 GN=Npcd PE=2 SV=1
18	Q4LDE5	3.36e-36	144	3571	0.178	0.022	SVEP1_HUMAN Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SVEP1 PE=1 SV=3
19	A0A1D5NSM8	8.71e-34	137	3615	0.162	0.019	A0A1D5NSM8_DANRE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing 1 OS=Danio rerio OX=7955 GN=svep1 PE=4 SV=1
20	A2AVA0	1.97e-31	130	3567	0.167	0.020	SVEP1_MOUSE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Svep1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16526 CLZ	2.1e+02	13.7	C-terminal leucine zipper domain of cyclic nucleotide-gated channels
2	PF20331 DUF6626	98	14.9	Family of unknown function (DUF6626)
3	PF07400 IL11	3.7e+02	12.1	Interleukin 11
4	PF02210 Laminin_G_2	65	15.5	Laminin G domain
5	PF13385 Laminin_G_3	4.9e-13	60.9	Concanavalin A-like lectin/glucanases superfamily
6	PF10037 MRP-S27	3.8e+02	11.4	Mitochondrial 28S ribosomal protein S27
7	PF00354 Pentaxin	1.4e-30	118.0	Pentaxin family
8	PF04508 Pox_A_type_inc	60	14.9	Viral A-type inclusion protein repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307549

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000319739	0.799	Reticulocalbin-2
2	9606.ENSP00000346659	0.671	P protein
3	9606.ENSP00000428994	0.668	Glutamate receptor 1
4	9606.ENSP00000374145	0.667	Acetylcholine receptor subunit gamma
5	9606.ENSP00000354488	0.654	Troponin I, slow skeletal muscle
6	9606.ENSP00000263256	0.645	Desumoylating isopeptidase 1
7	9606.ENSP00000347719	0.645	Tubulin-specific chaperone D
8	9606.ENSP00000359521	0.642	SLIT and NTRK-like protein 2
9	9606.ENSP00000361636	0.640	Troponin C, skeletal muscle
10	9606.ENSP00000267845	0.630	Histidine decarboxylase
11	9606.ENSP00000362481	0.625	Uracil phosphoribosyltransferase homolog
12	9606.ENSP00000354681	0.623	Dynamin-like 120 kDa protein, mitochondrial
13	9606.ENSP00000377696	0.618	Omega-amidase NIT2
14	9606.ENSP00000366288	0.617	SLIT and NTRK-like protein 1
15	9606.ENSP00000375069	0.612	Collagen type XXIII alpha 1 chain
16	9606.ENSP00000384966	0.610	Mitochondrial inner membrane protease subunit 2
17	9606.ENSP00000447006	0.596	Contactin-1
18	9606.ENSP00000251582	0.575	A disintegrin and metalloproteinase with thrombospondin motifs 2
19	9606.ENSP00000309501	0.547	NACHT and WD repeat domain containing 2
20	9606.ENSP00000304250	0.539	Cyclin-dependent kinase 5 activator 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0044877	0.454	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.989	biological regulation
GO:0032501	0.989	multicellular organismal process
GO:0009987	0.989	cellular process
GO:0007399	0.983	nervous system development
GO:0050794	0.980	regulation of cellular process
GO:0050896	0.870	response to stimulus
GO:0023051	0.853	regulation of signaling
GO:0010646	0.852	regulation of cell communication
GO:0007267	0.833	cell-cell signaling
GO:0071840	0.832	cellular component organization or biogenesis
GO:0016043	0.810	cellular component organization
GO:0031644	0.761	regulation of nervous system process
GO:0099536	0.725	synaptic signaling
GO:0099601	0.715	regulation of neurotransmitter receptor activity
GO:0048468	0.690	cell development
GO:0065008	0.609	regulation of biological quality
GO:0051179	0.570	localization
GO:0030030	0.559	cell projection organization
GO:0051641	0.547	cellular localization
GO:0099177	0.525	regulation of trans-synaptic signaling
GO:0050804	0.515	modulation of chemical synaptic transmission
GO:0051716	0.456	cellular response to stimulus
GO:0099072	0.365	regulation of postsynaptic membrane neurotransmitter receptor levels
GO:0007165	0.365	signal transduction
GO:1903539	0.364	protein localization to postsynaptic membrane
GO:0031503	0.303	protein-containing complex localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030054	0.998	cell junction
GO:0045202	0.991	synapse
GO:0098978	0.972	glutamatergic synapse
GO:0043226	0.959	organelle
GO:0016020	0.950	membrane
GO:0005622	0.944	intracellular anatomical structure
GO:0071944	0.934	cell periphery
GO:0005886	0.902	plasma membrane
GO:0043227	0.877	membrane-bounded organelle
GO:0005737	0.865	cytoplasm
GO:0043229	0.836	intracellular organelle
GO:0005576	0.813	extracellular region
GO:0043005	0.686	neuron projection
GO:0043231	0.634	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]