StarFunc result for job id Q15819

User Input

>input (145 residues)
MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYEN
RIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQ
ELRRLMMSKENMKLPQPPEGQTYNN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0M8W4	0.985	0.985	1.620E-28	145	1.000	1.000	A0M8W4.pdb.gz	A0M8W4_HUMAN Ubiquitin-conjugating enzyme E2 variant 2 OS=Homo sapiens OX=9606 GN=UBE2V2 PE=2 SV=1
2	PDB:7bbdA	0.962	0.937	2.527E-26	149	0.993	0.966	7bbdA.pdb.gz	RING domains act as both substrate and enzyme in a catalytic arrangement to drive self-anchored ubiquitination.
3	AFDB:I3L0A0	0.963	0.379	4.893E-26	370	0.890	0.349	I3L0A0.pdb.gz	I3L0A0_HUMAN HCG2044781 OS=Homo sapiens OX=9606 GN=PEDS1-UBE2V1 PE=1 SV=1
4	AFDB:F1R1E9	0.972	0.866	8.554E-26	163	0.828	0.736	F1R1E9.pdb.gz
5	AFDB:Q9VRL1	0.973	0.973	2.943E-24	145	0.648	0.648	Q9VRL1.pdb.gz	Q9VRL1_DROME GEO06356p1 OS=Drosophila melanogaster OX=7227 GN=Uev1A PE=1 SV=1
6	AFDB:O45495	0.929	0.969	3.727E-22	139	0.607	0.633	O45495.pdb.gz	UB2V1_CAEEL Ubiquitin-conjugating enzyme E2 variant 1 OS=Caenorhabditis elegans OX=6239 GN=uev-1 PE=1 SV=1
7	PDB:2hlwA	0.906	0.779	1.588E-21	170	0.883	0.753	2hlwA.pdb.gz
8	AFDB:O74983	0.928	0.968	7.333E-21	139	0.469	0.489	O74983.pdb.gz	MMS2_SCHPO Ubiquitin-conjugating enzyme spm2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spm2 PE=1 SV=1
9	AFDB:A0A1D8PFF9	0.916	0.969	6.850E-20	137	0.469	0.496	A0A1D8PFF9.pdb.gz	A0A1D8PFF9_CANAL E2 ubiquitin-conjugating protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MMS2 PE=4 SV=1
10	AFDB:Q9SVD7	0.972	0.966	7.289E-20	146	0.483	0.479	Q9SVD7.pdb.gz	UEV1D_ARATH Ubiquitin-conjugating enzyme E2 variant 1D OS=Arabidopsis thaliana OX=3702 GN=UEV1D PE=1 SV=1
11	AFDB:P53152	0.917	0.970	8.780E-20	137	0.469	0.496	P53152.pdb.gz	MMS2_YEAST Ubiquitin-conjugating enzyme variant MMS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MMS2 PE=1 SV=1
12	AFDB:F4J6Z1	0.957	0.848	1.968E-19	164	0.490	0.433	F4J6Z1.pdb.gz	F4J6Z1_ARATH Ubiquitin E2 variant 1D-4 OS=Arabidopsis thaliana OX=3702 GN=UEV1D-4 PE=1 SV=1
13	PDB:5ojwB	0.904	0.956	2.408E-18	137	0.469	0.496	5ojwB.pdb.gz
14	PDB:6d68A	0.713	0.653	1.018E-9	159	0.248	0.226	6d68A.pdb.gz
15	PDB:6cyrA	0.703	0.668	1.153E-9	153	0.200	0.190	6cyrA.pdb.gz
16	PDB:1i7kA	0.701	0.697	1.077E-8	146	0.248	0.247	1i7kA.pdb.gz
17	PDB:3e46A	0.716	0.522	1.469E-8	202	0.241	0.173	3e46A.pdb.gz
18	PDB:3bzhA	0.712	0.645	3.094E-8	161	0.228	0.205	3bzhA.pdb.gz
19	PDB:4x57C	0.718	0.700	3.503E-8	149	0.228	0.221	4x57C.pdb.gz
20	PDB:2aakA	0.700	0.678	4.490E-8	150	0.186	0.180	2aakA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0M8W4	3.57e-105	298	145	1.000	1.000	A0M8W4_HUMAN Ubiquitin-conjugating enzyme E2 variant 2 OS=Homo sapiens OX=9606 GN=UBE2V2 PE=2 SV=1
2	Q15819	3.57e-105	298	145	1.000	1.000	UB2V2_HUMAN Ubiquitin-conjugating enzyme E2 variant 2 OS=Homo sapiens OX=9606 GN=UBE2V2 PE=1 SV=4
3	Q7M767	2.90e-104	295	145	0.993	0.993	UB2V2_RAT Ubiquitin-conjugating enzyme E2 variant 2 OS=Rattus norvegicus OX=10116 GN=Ube2v2 PE=1 SV=3
4	Q9D2M8	4.66e-104	295	145	0.986	0.986	UB2V2_MOUSE Ubiquitin-conjugating enzyme E2 variant 2 OS=Mus musculus OX=10090 GN=Ube2v2 PE=1 SV=4
5	Q6PEH5	4.80e-100	285	145	0.938	0.938	UB2V2_DANRE Ubiquitin-conjugating enzyme E2 variant 2 OS=Danio rerio OX=7955 GN=ube2v2 PE=2 SV=1
6	Q13404	1.00e-93	269	147	0.903	0.891	UB2V1_HUMAN Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1 PE=1 SV=2
7	I3L0A0	4.23e-93	275	370	0.890	0.349	I3L0A0_HUMAN HCG2044781 OS=Homo sapiens OX=9606 GN=PEDS1-UBE2V1 PE=1 SV=1
8	Q9CZY3	1.56e-91	263	147	0.862	0.850	UB2V1_MOUSE Ubiquitin-conjugating enzyme E2 variant 1 OS=Mus musculus OX=10090 GN=Ube2v1 PE=1 SV=1
9	Q3B7F0	4.54e-89	257	147	0.828	0.816	Q3B7F0_DANRE Ubiquitin-conjugating enzyme E2 variant 1 OS=Danio rerio OX=7955 GN=zgc:123326 PE=1 SV=1
10	Q9VRL1	6.49e-72	214	145	0.648	0.648	Q9VRL1_DROME GEO06356p1 OS=Drosophila melanogaster OX=7227 GN=Uev1A PE=1 SV=1
11	O45495	3.64e-64	194	139	0.607	0.633	UB2V1_CAEEL Ubiquitin-conjugating enzyme E2 variant 1 OS=Caenorhabditis elegans OX=6239 GN=uev-1 PE=1 SV=1
12	Q9SJ44	3.15e-52	164	145	0.497	0.497	UEV1C_ARATH Ubiquitin-conjugating enzyme E2 variant 1C OS=Arabidopsis thaliana OX=3702 GN=UEV1C PE=1 SV=1
13	Q93YP0	3.99e-51	162	158	0.490	0.449	UEV1A_ARATH Ubiquitin-conjugating enzyme E2 variant 1A OS=Arabidopsis thaliana OX=3702 GN=UEV1A PE=1 SV=1
14	Q9SVD7	3.83e-50	159	146	0.483	0.479	UEV1D_ARATH Ubiquitin-conjugating enzyme E2 variant 1D OS=Arabidopsis thaliana OX=3702 GN=UEV1D PE=1 SV=1
15	O74983	1.87e-49	157	139	0.469	0.489	MMS2_SCHPO Ubiquitin-conjugating enzyme spm2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spm2 PE=1 SV=1
16	Q9CAB6	8.24e-49	155	159	0.476	0.434	UEV1B_ARATH Ubiquitin-conjugating enzyme E2 variant 1B OS=Arabidopsis thaliana OX=3702 GN=UEV1B PE=1 SV=1
17	P53152	8.39e-49	155	137	0.469	0.496	MMS2_YEAST Ubiquitin-conjugating enzyme variant MMS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MMS2 PE=1 SV=1
18	A0A1D8PFF9	3.70e-46	148	137	0.469	0.496	A0A1D8PFF9_CANAL E2 ubiquitin-conjugating protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MMS2 PE=4 SV=1
19	F4J6Z1	5.71e-46	149	164	0.483	0.427	F4J6Z1_ARATH Ubiquitin E2 variant 1D-4 OS=Arabidopsis thaliana OX=3702 GN=UEV1D-4 PE=1 SV=1
20	Q57YD9	8.40e-10	56.2	172	0.241	0.203	Q57YD9_TRYB2 Ubiquitin-conjugating enzyme E2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.12O16.620 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05773 RWD	1.2e+02	14.4	RWD domain
2	PF00179 UQ_con	1.3e-14	65.5	Ubiquitin-conjugating enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 89462.XP_006063486.1

Rank	PPI partner	STRING score	Description
1	89462.XP_006070283.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns
2	89462.XP_006043825.1	0.983	SUMO-conjugating enzyme UBC9 isoform X1
3	89462.XP_006066820.1	0.968	NEDD8-conjugating enzyme UBE2F isoform X1
4	89462.XP_006045602.1	0.952	Ubiquitin-conjugating enzyme E2 L3-like isoform X1
5	89462.XP_006048493.1	0.952	Ubiquitin-conjugating enzyme E2 L3-like isoform X1
6	89462.XP_006065698.1	0.952	Uncharacterized protein LOC102407363
7	89462.XP_006063190.1	0.948	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 3 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments
8	89462.XP_006042865.1	0.944	Ubiquitin-conjugating enzyme E2 B isoform X1
9	89462.XP_006049975.1	0.940	E3 ubiquitin-protein ligase CHIP
10	89462.XP_006066212.1	0.937	Ubiquitin-conjugating enzyme E2 K-like
11	89462.XP_006068310.1	0.937	Ubiquitin-conjugating enzyme E2 K-like
12	89462.XP_006050061.1	0.932	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 149 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns
13	89462.XP_006074465.1	0.932	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 293 Proteins, and 62% coverage of the annotated genomic feature by RNAseq alignments
14	89462.XP_006079523.1	0.932	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 EST, 152 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns
15	89462.XP_006074834.1	0.928	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
16	89462.XP_006070861.1	0.924	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 37 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
17	89462.XP_006046167.1	0.920	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
18	89462.XP_006050917.1	0.918	Ubiquitin thioesterase OTUB1
19	89462.XP_006047379.1	0.902	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 7 samples with support for all annotated introns
20	89462.XP_006064141.1	0.902	Ubiquitin-conjugating enzyme E2 D3-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004842	0.950	ubiquitin-protein transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.989	organic substance metabolic process
GO:0044238	0.987	primary metabolic process
GO:0006807	0.984	nitrogen compound metabolic process
GO:0044237	0.982	cellular metabolic process
GO:0043170	0.982	macromolecule metabolic process
GO:0050789	0.978	regulation of biological process
GO:0050794	0.973	regulation of cellular process
GO:0050896	0.948	response to stimulus
GO:0060255	0.947	regulation of macromolecule metabolic process
GO:2001020	0.946	regulation of response to DNA damage stimulus
GO:0051052	0.938	regulation of DNA metabolic process
GO:0032446	0.931	protein modification by small protein conjugation
GO:0048518	0.905	positive regulation of biological process
GO:0044260	0.894	cellular macromolecule metabolic process
GO:0016567	0.887	protein ubiquitination
GO:0000209	0.880	protein polyubiquitination
GO:0051173	0.862	positive regulation of nitrogen compound metabolic process
GO:0051716	0.853	cellular response to stimulus
GO:0010604	0.851	positive regulation of macromolecule metabolic process
GO:0070534	0.824	protein K63-linked ubiquitination
GO:0006282	0.806	regulation of DNA repair
GO:0051054	0.802	positive regulation of DNA metabolic process
GO:0006281	0.793	DNA repair
GO:0051247	0.785	positive regulation of protein metabolic process
GO:0031399	0.702	regulation of protein modification process
GO:2001022	0.675	positive regulation of response to DNA damage stimulus
GO:0045739	0.650	positive regulation of DNA repair
GO:1903320	0.598	regulation of protein modification by small protein conjugation or removal
GO:0006301	0.541	postreplication repair
GO:0031401	0.532	positive regulation of protein modification process
GO:1903322	0.522	positive regulation of protein modification by small protein conjugation or removal
GO:0031396	0.518	regulation of protein ubiquitination
GO:0031398	0.492	positive regulation of protein ubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.999	cytoplasm
GO:0032991	0.998	protein-containing complex
GO:0005829	0.970	cytosol
GO:0140535	0.956	intracellular protein-containing complex
GO:0005576	0.947	extracellular region
GO:1990234	0.945	transferase complex
GO:0031982	0.904	vesicle
GO:0070062	0.887	extracellular exosome
GO:0031371	0.727	ubiquitin conjugating enzyme complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.952	Transferases.

[back to server]