StarFunc result for job id Q15822

User Input

>input (529 residues)
MGPSCPVFLSFTKLSLWWLLLTPAGGEEAKRPPPRAPGDPLSSPSPTALPQGGSHTETED
RLFKHLFRGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKL
RWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYK
SSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQMEQTVDLKDYWESGEWAIVNATGTY
NSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLC
ISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTH
TMPHWVRGALLGCVPRWLLMNRPPPPVELCHPLRLKLSPSYHWLESNVDAEEREVVVEEE
DRWACAGHVAPSVGTLCSHGHLHSGASGPKAEALLQEGELLLSPHMQKALEGVHYIADHL
RSEDADSSVKEDWKYVAMVIDRIFLWLFIIVCFLGTIGLFLPPFLAGMI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15822	1.000	1.000	2.349E-94	529	1.000	1.000	Q15822.pdb.gz	ACHA2_HUMAN Neuronal acetylcholine receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=CHRNA2 PE=1 SV=2
2	AFDB:Q91X60	0.800	0.826	2.173E-76	512	0.820	0.848	Q91X60.pdb.gz	ACHA2_MOUSE Neuronal acetylcholine receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Chrna2 PE=2 SV=1
3	AFDB:B3DGY1	0.786	0.799	2.781E-70	520	0.686	0.698	B3DGY1.pdb.gz
4	AFDB:P09482	0.763	0.650	1.102E-66	622	0.660	0.561	P09482.pdb.gz	ACHA4_CHICK Neuronal acetylcholine receptor subunit alpha-4 OS=Gallus gallus OX=9031 GN=CHRNA4 PE=1 SV=1
5	AFDB:P43681	0.754	0.637	3.104E-66	627	0.662	0.558	P43681.pdb.gz	ACHA4_HUMAN Neuronal acetylcholine receptor subunit alpha-4 OS=Homo sapiens OX=9606 GN=CHRNA4 PE=1 SV=2
6	AFDB:P09483	0.749	0.630	7.424E-66	630	0.656	0.551	P09483.pdb.gz	ACHA4_RAT Neuronal acetylcholine receptor subunit alpha-4 OS=Rattus norvegicus OX=10116 GN=Chrna4 PE=1 SV=3
7	AFDB:Q0PJT8	0.755	0.637	3.968E-64	627	0.629	0.531	Q0PJT8.pdb.gz	Q0PJT8_DANRE Cholinergic receptor, nicotinic, alpha 4b OS=Danio rerio OX=7955 GN=LOC556619 PE=2 SV=1
8	AFDB:Q15825	0.766	0.819	1.551E-59	494	0.497	0.532	Q15825.pdb.gz	ACHA6_HUMAN Neuronal acetylcholine receptor subunit alpha-6 OS=Homo sapiens OX=9606 GN=CHRNA6 PE=1 SV=1
9	AFDB:P32297	0.763	0.799	3.328E-59	505	0.543	0.568	P32297.pdb.gz	ACHA3_HUMAN Neuronal acetylcholine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=CHRNA3 PE=1 SV=4
10	AFDB:Q9R0W9	0.762	0.815	6.759E-59	494	0.482	0.516	Q9R0W9.pdb.gz	ACHA6_MOUSE Neuronal acetylcholine receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Chrna6 PE=2 SV=2
11	PDB:4aq5E	0.472	0.650	2.137E-23	370	0.240	0.343	4aq5E.pdb.gz
12	PDB:6i53B	0.497	0.761	5.398E-23	338	0.125	0.195	6i53B.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
13	PDB:6i53A	0.510	0.757	8.699E-22	349	0.112	0.169	6i53A.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
14	PDB:4hfcA	0.462	0.760	8.469E-20	311	0.106	0.180	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
15	PDB:7kuyE	0.472	0.713	5.116E-19	338	0.149	0.234	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
16	PDB:2w8gC	0.364	0.857	1.097E-18	217	0.113	0.276	2w8gC.pdb.gz	Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
17	PDB:4afhA	0.354	0.847	1.999E-18	213	0.113	0.282	4afhA.pdb.gz	Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
18	PDB:7l6qA	0.441	0.727	2.627E-14	311	0.110	0.186	7l6qA.pdb.gz	Structure and function at the lipid-protein interface of a pentameric ligand-gated ion channel.
19	PDB:6zgdA	0.389	0.683	2.814E-11	288	0.104	0.191	6zgdA.pdb.gz
20	PDB:4wz9B	0.116	0.082	2.033E-3	887	0.042	0.025	4wz9B.pdb.gz	The Anopheles-midgut APN1 structure reveals a new malaria transmission-blocking vaccine epitope.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0X1KG79	0.0	1043	507	0.957	0.998	A0A0X1KG79_HUMAN Cholinergic receptor nicotinic alpha 2 subunit OS=Homo sapiens OX=9606 GN=CHRNA2 PE=3 SV=1
2	O70174	0.0	552	629	0.516	0.434	ACHA4_MOUSE Neuronal acetylcholine receptor subunit alpha-4 OS=Mus musculus OX=10090 GN=Chrna4 PE=1 SV=2
3	P04757	0.0	554	499	0.543	0.575	ACHA3_RAT Neuronal acetylcholine receptor subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Chrna3 PE=1 SV=1
4	P09481	0.0	560	496	0.537	0.573	ACHA3_CHICK Neuronal acetylcholine receptor subunit alpha-3 OS=Gallus gallus OX=9031 GN=CHRNA3 PE=1 SV=2
5	P09482	0.0	552	622	0.526	0.447	ACHA4_CHICK Neuronal acetylcholine receptor subunit alpha-4 OS=Gallus gallus OX=9031 GN=CHRNA4 PE=1 SV=1
6	P09483	0.0	547	630	0.516	0.433	ACHA4_RAT Neuronal acetylcholine receptor subunit alpha-4 OS=Rattus norvegicus OX=10116 GN=Chrna4 PE=1 SV=3
7	P12389	0.0	811	511	0.803	0.832	ACHA2_RAT Neuronal acetylcholine receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Chrna2 PE=2 SV=2
8	P32297	0.0	555	505	0.529	0.554	ACHA3_HUMAN Neuronal acetylcholine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=CHRNA3 PE=1 SV=4
9	P43681	0.0	555	627	0.522	0.440	ACHA4_HUMAN Neuronal acetylcholine receptor subunit alpha-4 OS=Homo sapiens OX=9606 GN=CHRNA4 PE=1 SV=2
10	Q0PJT8	0.0	541	627	0.495	0.418	Q0PJT8_DANRE Cholinergic receptor, nicotinic, alpha 4b OS=Danio rerio OX=7955 GN=LOC556619 PE=2 SV=1
11	Q15822	0.0	1088	529	1.000	1.000	ACHA2_HUMAN Neuronal acetylcholine receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=CHRNA2 PE=1 SV=2
12	Q1RLX8	0.0	699	520	0.688	0.700	Q1RLX8_DANRE Cholinergic receptor, nicotinic, alpha 2a (neuronal) OS=Danio rerio OX=7955 GN=zgc:136717 PE=2 SV=1
13	Q8R4G9	0.0	557	499	0.541	0.573	ACHA3_MOUSE Neuronal acetylcholine receptor subunit alpha-3 OS=Mus musculus OX=10090 GN=Chrna3 PE=2 SV=1
14	Q91X60	0.0	824	512	0.819	0.846	ACHA2_MOUSE Neuronal acetylcholine receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Chrna2 PE=2 SV=1
15	Q9R0W9	0.0	520	494	0.488	0.522	ACHA6_MOUSE Neuronal acetylcholine receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Chrna6 PE=2 SV=2
16	Q15825	2.19e-179	515	494	0.491	0.526	ACHA6_HUMAN Neuronal acetylcholine receptor subunit alpha-6 OS=Homo sapiens OX=9606 GN=CHRNA6 PE=1 SV=1
17	P43143	1.02e-178	513	493	0.491	0.527	ACHA6_RAT Neuronal acetylcholine receptor subunit alpha-6 OS=Rattus norvegicus OX=10116 GN=Chrna6 PE=2 SV=1
18	P12391	4.62e-171	493	464	0.478	0.545	ACHB3_RAT Neuronal acetylcholine receptor subunit beta-3 OS=Rattus norvegicus OX=10116 GN=Chrnb3 PE=2 SV=1
19	Q8BMN3	9.09e-169	487	464	0.474	0.541	ACHB3_MOUSE Neuronal acetylcholine receptor subunit beta-3 OS=Mus musculus OX=10090 GN=Chrnb3 PE=2 SV=1
20	Q05901	4.93e-164	475	458	0.473	0.546	ACHB3_HUMAN Neuronal acetylcholine receptor subunit beta-3 OS=Homo sapiens OX=9606 GN=CHRNB3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03154 Atrophin-1	47	13.7	Atrophin-1 family
2	PF02931 Neur_chan_LBD	5.5e-77	269.6	Neurotransmitter-gated ion-channel ligand binding domain
3	PF02932 Neur_chan_memb	6.3e-91	316.2	Neurotransmitter-gated ion-channel transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000385026

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357461	0.941	Neuronal acetylcholine receptor subunit beta-2
2	9606.ENSP00000261751	0.937	Neuronal acetylcholine receptor subunit beta-4
3	9606.ENSP00000407546	0.928	Neuronal acetylcholine receptor subunit alpha-7
4	9606.ENSP00000312663	0.909	Neuronal acetylcholine receptor subunit alpha-9
5	9606.ENSP00000359285	0.906	Neuronal acetylcholine receptor subunit alpha-4
6	9606.ENSP00000315602	0.905	Neuronal acetylcholine receptor subunit alpha-3
7	9606.ENSP00000289957	0.816	Neuronal acetylcholine receptor subunit beta-3
8	9606.ENSP00000304290	0.739	Acetylcholine receptor subunit beta
9	9606.ENSP00000301908	0.727	Prepronociceptin
10	9606.ENSP00000360822	0.708	Potassium channel subfamily T member 1
11	9606.ENSP00000409378	0.701	Muscarinic acetylcholine receptor M4
12	9606.ENSP00000399745	0.699	Muscarinic acetylcholine receptor M2
13	9606.ENSP00000298854	0.692	43 kDa receptor-associated protein of the synapse
14	9606.ENSP00000299847	0.666	CHRNA7-FAM7A fusion protein
15	9606.ENSP00000344432	0.657	Protein Dok-7
16	9606.ENSP00000299565	0.651	Neuronal acetylcholine receptor subunit alpha-5
17	9606.ENSP00000363571	0.647	Muscle, skeletal receptor tyrosine-protein kinase
18	9606.ENSP00000368678	0.646	Agrin
19	9606.ENSP00000367888	0.640	Low-density lipoprotein receptor-related protein 4
20	9606.ENSP00000246515	0.634	Secreted Ly-6/uPAR-related protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004888	0.999	transmembrane signaling receptor activity
GO:0022848	0.999	acetylcholine-gated monoatomic cation-selective channel activity
GO:0005488	0.992	binding
GO:0015464	0.986	acetylcholine receptor activity
GO:0005515	0.984	protein binding
GO:0050997	0.718	quaternary ammonium group binding
GO:0015318	0.467	inorganic molecular entity transmembrane transporter activity
GO:1901702	0.408	salt transmembrane transporter activity
GO:0042166	0.345	acetylcholine binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.999	response to stimulus
GO:0042391	0.995	regulation of membrane potential
GO:0009987	0.990	cellular process
GO:0050789	0.979	regulation of biological process
GO:0050794	0.969	regulation of cellular process
GO:0007154	0.935	cell communication
GO:0023052	0.933	signaling
GO:0051899	0.883	membrane depolarization
GO:0051716	0.816	cellular response to stimulus
GO:0007165	0.787	signal transduction
GO:0032501	0.592	multicellular organismal process
GO:0042221	0.571	response to chemical
GO:0007267	0.401	cell-cell signaling
GO:0099536	0.346	synaptic signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.998	protein-containing complex
GO:0005622	0.985	intracellular anatomical structure
GO:0043227	0.981	membrane-bounded organelle
GO:0043229	0.978	intracellular organelle
GO:0043231	0.972	intracellular membrane-bounded organelle
GO:0043235	0.970	receptor complex
GO:0098797	0.969	plasma membrane protein complex
GO:0034702	0.967	ion channel complex
GO:0005737	0.907	cytoplasm
GO:0098802	0.896	plasma membrane signaling receptor complex
GO:0005892	0.852	acetylcholine-gated channel complex
GO:0005634	0.788	nucleus
GO:0031981	0.748	nuclear lumen
GO:0005654	0.667	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]