StarFunc result for job id Q15831

User Input

>input (433 residues)
MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY
GKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPG
NLLLTTGGTLKISDLGVAEALHPFAADDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS
AGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSI
RQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDI
IYTQDFTVPGQVPEEEASHNGQRRGLPKAVCMNGTEAAQLSTKSRAEGRAPNPARKACSA
SSKIRRLSACKQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q0GGW5	0.809	0.796	1.121E-73	440	0.905	0.891	Q0GGW5.pdb.gz	STK11_CHICK Serine/threonine-protein kinase STK11 OS=Gallus gallus OX=9031 GN=STK11 PE=2 SV=1
2	AFDB:F1S6Q9	0.752	0.744	4.062E-73	438	0.931	0.920	F1S6Q9.pdb.gz	F1S6Q9_PIG non-specific serine/threonine protein kinase OS=Sus scrofa OX=9823 GN=STK11 PE=3 SV=4
3	AFDB:D4AE59	0.813	0.808	1.379E-71	436	0.910	0.904	D4AE59.pdb.gz	STK11_RAT Serine/threonine-protein kinase STK11 OS=Rattus norvegicus OX=10116 GN=Stk11 PE=1 SV=2
4	AFDB:Q568P5	0.790	0.778	3.207E-65	440	0.829	0.816	Q568P5.pdb.gz	Q568P5_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=zgc:110180 PE=1 SV=1
5	AFDB:Q8T9L5	0.707	0.543	7.893E-46	567	0.501	0.383	Q8T9L5.pdb.gz	Q8T9L5_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Lkb1 PE=2 SV=1
6	AFDB:Q9GN62	0.657	0.464	6.911E-37	617	0.367	0.258	Q9GN62.pdb.gz	PAR4_CAEEL Serine/threonine-protein kinase par-4 OS=Caenorhabditis elegans OX=6239 GN=par-4 PE=1 SV=2
7	AFDB:Q54WJ0	0.641	0.478	1.394E-33	586	0.349	0.258	Q54WJ0.pdb.gz	STK11_DICDI Serine/threonine-protein kinase stk11 homolog OS=Dictyostelium discoideum OX=44689 GN=lkb1 PE=3 SV=1
8	AFDB:A0A1D8PN61	0.582	0.411	2.451E-27	618	0.279	0.196	A0A1D8PN61.pdb.gz	A0A1D8PN61_CANAL non-specific serine/threonine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SNF1 PE=4 SV=1
9	AFDB:Q00372	0.575	0.410	2.173E-26	612	0.279	0.198	Q00372.pdb.gz	SNF1_CANGA Carbon catabolite-derepressing protein kinase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=SNF1 PE=3 SV=2
10	AFDB:A1ZBL7	0.580	0.258	5.318E-26	993	0.252	0.110	A1ZBL7.pdb.gz	A1ZBL7_DROME Par-1, isoform H OS=Drosophila melanogaster OX=7227 GN=par-1 PE=1 SV=1
11	PDB:6b1uA	0.568	0.557	1.371E-24	442	0.222	0.217	6b1uA.pdb.gz	Structural Determinants for Small-Molecule Activation of Skeletal Muscle AMPK alpha 2 beta 2 gamma 1 by the Glucose Importagog SC4.
12	PDB:5ufuA	0.558	0.649	1.918E-24	369	0.222	0.260	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
13	PDB:7myjC	0.559	0.522	2.029E-24	465	0.222	0.206	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
14	PDB:4zhxA	0.567	0.599	5.873E-24	409	0.222	0.235	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
15	PDB:4rerA	0.569	0.538	1.902E-23	459	0.229	0.216	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
16	PDB:4rewA	0.567	0.596	6.159E-23	411	0.229	0.241	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
17	PDB:5u6yA	0.546	0.516	4.616E-22	459	0.199	0.187	5u6yA.pdb.gz
18	PDB:1unlA	0.540	0.785	4.328E-21	292	0.176	0.260	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
19	PDB:4eomC	0.538	0.822	5.413E-21	276	0.173	0.272	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
20	PDB:6byrA	0.582	0.620	5.075E-20	405	0.187	0.200	6byrA.pdb.gz	Structures of the PKA RI alpha Holoenzyme with the FLHCC Driver J-PKAc alpha or Wild-Type PKAc alpha.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z4D1	0.0	902	433	1.000	1.000	A0A0S2Z4D1_HUMAN non-specific serine/threonine protein kinase (Fragment) OS=Homo sapiens OX=9606 GN=STK11 PE=2 SV=1
2	D4AE59	0.0	750	436	0.910	0.904	STK11_RAT Serine/threonine-protein kinase STK11 OS=Rattus norvegicus OX=10116 GN=Stk11 PE=1 SV=2
3	F1S6Q9	0.0	810	438	0.933	0.922	F1S6Q9_PIG non-specific serine/threonine protein kinase OS=Sus scrofa OX=9823 GN=STK11 PE=3 SV=4
4	Q0GGW5	0.0	754	440	0.903	0.889	STK11_CHICK Serine/threonine-protein kinase STK11 OS=Gallus gallus OX=9031 GN=STK11 PE=2 SV=1
5	Q15831	0.0	902	433	1.000	1.000	STK11_HUMAN Serine/threonine-protein kinase STK11 OS=Homo sapiens OX=9606 GN=STK11 PE=1 SV=1
6	Q568P5	0.0	656	440	0.818	0.805	Q568P5_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=zgc:110180 PE=1 SV=1
7	Q9WTK7	0.0	767	436	0.905	0.899	STK11_MOUSE Serine/threonine-protein kinase STK11 OS=Mus musculus OX=10090 GN=Stk11 PE=1 SV=1
8	Q8T9L5	2.15e-153	448	567	0.480	0.367	Q8T9L5_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=Lkb1 PE=2 SV=1
9	Q54WJ0	1.26e-82	266	586	0.319	0.235	STK11_DICDI Serine/threonine-protein kinase stk11 homolog OS=Dictyostelium discoideum OX=44689 GN=lkb1 PE=3 SV=1
10	Q9GN62	5.90e-79	258	617	0.319	0.224	PAR4_CAEEL Serine/threonine-protein kinase par-4 OS=Caenorhabditis elegans OX=6239 GN=par-4 PE=1 SV=2
11	Q9FJ55	5.74e-53	186	483	0.282	0.253	CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana OX=3702 GN=CIPK19 PE=1 SV=1
12	Q38997	7.67e-52	184	512	0.249	0.211	KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana OX=3702 GN=KIN10 PE=1 SV=3
13	Q9SN43	9.65e-52	183	489	0.229	0.202	CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana OX=3702 GN=CIPK12 PE=1 SV=1
14	B9DFC1	1.77e-51	182	512	0.249	0.211	B9DFC1_ARATH non-specific serine/threonine protein kinase OS=Arabidopsis thaliana OX=3702 GN=At3g01090 PE=1 SV=1
15	Q9FJ54	1.12e-50	179	439	0.259	0.255	CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana OX=3702 GN=CIPK20 PE=1 SV=1
16	P92958	2.97e-50	179	512	0.245	0.207	KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana OX=3702 GN=KIN11 PE=1 SV=1
17	Q57YE4	1.21e-49	172	296	0.238	0.348	Q57YE4_TRYB2 Serine/threonine kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.12O16.490 PE=3 SV=1
18	Q84XC0	1.81e-49	177	516	0.229	0.192	Q84XC0_PEA non-specific serine/threonine protein kinase OS=Pisum sativum OX=3888 PE=1 SV=1
19	Q2PUH1	2.47e-49	178	560	0.231	0.179	Q2PUH1_CHICK Acetyl-CoA carboxylase kinase OS=Gallus gallus OX=9031 GN=PRKAA1 PE=1 SV=1
20	Q84VQ3	4.61e-49	174	439	0.226	0.223	CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana OX=3702 GN=CIPK26 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1.1	19.8	ABC1 atypical kinase-like domain
2	PF01636 APH	1.4e+02	13.7	Phosphotransferase enzyme family
3	PF06293 Kdo	1.4e+02	13.3	Lipopolysaccharide kinase (Kdo/WaaP) family
4	PF14531 Kinase-like	6.2e-08	43.9	Kinase-like
5	PF00069 Pkinase	1.8e-54	196.5	Protein kinase domain
6	PF17667 Pkinase_fungal	86	13.3	Fungal protein kinase
7	PF07714 PK_Tyr_Ser-Thr	5.2e-32	122.7	Protein tyrosine and serine/threonine kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000324856

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258418	0.999	Calcium-binding protein 39
2	9606.ENSP00000335153	0.999	Heat shock protein HSP 90-alpha
3	9606.ENSP00000336655	0.999	STE20-related kinase adapter protein alpha
4	9606.ENSP00000479669	0.995	Calcium-binding protein 39-like
5	9606.ENSP00000194530	0.993	STE20-related kinase adapter protein beta
6	9606.ENSP00000262320	0.992	Axin-1
7	9606.ENSP00000269305	0.992	Cellular tumor antigen p53
8	9606.ENSP00000222005	0.981	Hsp90 co-chaperone Cdc37
9	9606.ENSP00000346148	0.980	5'-AMP-activated protein kinase catalytic subunit alpha-1
10	9606.ENSP00000360290	0.980	5'-AMP-activated protein kinase catalytic subunit alpha-2
11	9606.ENSP00000229328	0.976	5'-AMP-activated protein kinase subunit beta-1
12	9606.ENSP00000253063	0.976	Sestrin-2
13	9606.ENSP00000405330	0.976	Estrogen receptor
14	9606.ENSP00000341551	0.974	Mothers against decapentaplegic homolog 4
15	9606.ENSP00000295641	0.973	Serine/threonine-protein kinase 11-interacting protein
16	9606.ENSP00000254101	0.968	5'-AMP-activated protein kinase subunit beta-2
17	9606.ENSP00000385751	0.966	Serine/threonine-protein kinase MARK2
18	9606.ENSP00000287878	0.965	5'-AMP-activated protein kinase subunit gamma-2
19	9606.ENSP00000385824	0.963	Forkhead box protein O3
20	9606.ENSP00000323867	0.959	5'-AMP-activated protein kinase subunit gamma-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0004674	0.998	protein serine/threonine kinase activity
GO:0019899	0.537	enzyme binding
GO:1901363	0.365	heterocyclic compound binding
GO:0097159	0.364	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050794	0.992	regulation of cellular process
GO:0071704	0.989	organic substance metabolic process
GO:0019222	0.989	regulation of metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0050896	0.986	response to stimulus
GO:0044238	0.984	primary metabolic process
GO:0043170	0.974	macromolecule metabolic process
GO:0031323	0.966	regulation of cellular metabolic process
GO:0006807	0.965	nitrogen compound metabolic process
GO:0043412	0.959	macromolecule modification
GO:1901564	0.956	organonitrogen compound metabolic process
GO:0080090	0.956	regulation of primary metabolic process
GO:0019538	0.949	protein metabolic process
GO:0016310	0.942	phosphorylation
GO:0036211	0.938	protein modification process
GO:0048518	0.931	positive regulation of biological process
GO:0006468	0.923	protein phosphorylation
GO:0051716	0.851	cellular response to stimulus
GO:0032501	0.844	multicellular organismal process
GO:0032502	0.841	developmental process
GO:0060255	0.822	regulation of macromolecule metabolic process
GO:0048856	0.794	anatomical structure development
GO:0048522	0.777	positive regulation of cellular process
GO:0009893	0.767	positive regulation of metabolic process
GO:0051171	0.765	regulation of nitrogen compound metabolic process
GO:0031325	0.762	positive regulation of cellular metabolic process
GO:0032386	0.760	regulation of intracellular transport
GO:0048519	0.759	negative regulation of biological process
GO:0007154	0.746	cell communication
GO:0007275	0.732	multicellular organism development
GO:0048523	0.712	negative regulation of cellular process
GO:0042221	0.710	response to chemical
GO:0032388	0.703	positive regulation of intracellular transport
GO:0048731	0.632	system development
GO:0042592	0.572	homeostatic process
GO:0006950	0.507	response to stress
GO:0023051	0.502	regulation of signaling
GO:0010646	0.501	regulation of cell communication
GO:0010604	0.495	positive regulation of macromolecule metabolic process
GO:0051173	0.486	positive regulation of nitrogen compound metabolic process
GO:0048583	0.481	regulation of response to stimulus
GO:0007165	0.475	signal transduction
GO:0009966	0.460	regulation of signal transduction
GO:0009889	0.456	regulation of biosynthetic process
GO:0030154	0.451	cell differentiation
GO:0071840	0.443	cellular component organization or biogenesis
GO:0051246	0.441	regulation of protein metabolic process
GO:0016043	0.406	cellular component organization
GO:0010468	0.385	regulation of gene expression
GO:0031326	0.383	regulation of cellular biosynthetic process
GO:0009894	0.382	regulation of catabolic process
GO:0065009	0.371	regulation of molecular function
GO:0033554	0.331	cellular response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005654	0.995	nucleoplasm
GO:0032991	0.923	protein-containing complex
GO:0016020	0.866	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.998	Phosphotransferases with an alcohol group as acceptor.

[back to server]