StarFunc result for job id Q15843

User Input

>input (81 residues)
MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYK
ILGGSVLHLVLALRGGGGLRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9VJ33	0.937	0.904	4.996E-15	84	0.877	0.845	Q9VJ33.pdb.gz	NEDD8_DROME NEDD8 OS=Drosophila melanogaster OX=7227 GN=Nedd8 PE=1 SV=1
2	AFDB:F1QMF9	0.934	0.852	5.335E-15	89	0.926	0.843	F1QMF9.pdb.gz	F1QMF9_DANRE NEDD8 OS=Danio rerio OX=7955 GN=si:zc14a17.5 PE=3 SV=1
3	AFDB:Q93725	0.935	0.983	1.030E-14	77	0.827	0.870	Q93725.pdb.gz	NEDD8_CAEEL NEDD8 OS=Caenorhabditis elegans OX=6239 GN=ned-8 PE=1 SV=1
4	AFDB:Q5AZV1	0.943	0.943	1.172E-13	81	0.753	0.753	Q5AZV1.pdb.gz	Q5AZV1_EMENI Ubiquitin-like domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06179 PE=4 SV=1
5	AFDB:Q9SHE7	0.909	0.478	4.980E-13	156	0.802	0.417	Q9SHE7.pdb.gz	RUB1_ARATH Ubiquitin-NEDD8-like protein RUB1 OS=Arabidopsis thaliana OX=3702 GN=RUB1 PE=1 SV=3
6	PDB:3dbhI	0.861	0.812	6.920E-13	86	0.926	0.872	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
7	AFDB:P0C016	0.927	0.504	1.523E-12	150	0.543	0.293	P0C016.pdb.gz	RS27A_SCHPO Ubiquitin-ribosomal protein eS31A fusion protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubi3 PE=1 SV=2
8	AFDB:P05759	0.921	0.494	2.259E-12	152	0.519	0.276	P05759.pdb.gz	RS31_YEAST Ubiquitin-ribosomal protein eS31 fusion protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPS31 PE=1 SV=3
9	AFDB:P59232	0.924	0.482	2.752E-12	157	0.543	0.280	P59232.pdb.gz	R27AB_ARATH Ubiquitin-ribosomal protein eS31y fusion protein OS=Arabidopsis thaliana OX=3702 GN=RPS27AB PE=2 SV=2
10	AFDB:P15357	0.925	0.485	3.138E-12	156	0.556	0.288	P15357.pdb.gz	RS27A_DROME Ubiquitin-ribosomal protein eS31 fusion protein OS=Drosophila melanogaster OX=7227 GN=RpS27A PE=1 SV=2
11	AFDB:P49632	0.915	0.583	3.579E-12	128	0.531	0.336	P49632.pdb.gz	RL40_CAEEL Ubiquitin-ribosomal protein eL40 fusion protein OS=Caenorhabditis elegans OX=6239 GN=ubq-2 PE=3 SV=2
12	PDB:3ai5A	0.857	0.236	2.930E-10	299	0.494	0.134	3ai5A.pdb.gz
13	PDB:6ef3u	0.831	0.892	8.389E-10	75	0.506	0.547	6ef3u.pdb.gz	Substrate-engaged 26Sproteasome structures reveal mechanisms for ATP-hydrolysis-driven translocation.
14	PDB:7rbsB	0.884	0.467	1.723E-7	157	0.247	0.127	7rbsB.pdb.gz	Dual domain recognition determines SARS-CoV-2 PLpro selectivity for human ISG15 and K48-linked di-ubiquitin.
15	PDB:6yvaC	0.891	0.475	2.099E-7	155	0.235	0.123	6yvaC.pdb.gz
16	PDB:6mdhA	0.851	0.471	2.731E-7	149	0.247	0.134	6mdhA.pdb.gz
17	PDB:4pyuA	0.844	0.897	6.418E-7	76	0.160	0.171	4pyuA.pdb.gz	The conserved ubiquitin-like protein Hub1 plays a critical role in splicing in human cells.
18	PDB:3plvA	0.862	0.873	8.916E-7	80	0.185	0.188	3plvA.pdb.gz	Role of the ubiquitin-like protein Hub1 in splice-site usage and alternative splicing.
19	PDB:2lrwA	0.651	0.670	4.926E-6	78	0.358	0.372	2lrwA.pdb.gz
20	PDB:4zynB	0.838	0.187	9.507E-6	385	0.198	0.042	4zynB.pdb.gz	A Ubl/ubiquitin switch in the activation of Parkin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15843	1.70e-52	159	81	1.000	1.000	NEDD8_HUMAN NEDD8 OS=Homo sapiens OX=9606 GN=NEDD8 PE=1 SV=1
2	P29595	3.16e-51	156	81	0.988	0.988	NEDD8_MOUSE NEDD8 OS=Mus musculus OX=10090 GN=Nedd8 PE=1 SV=2
3	Q71UE8	3.16e-51	156	81	0.988	0.988	NEDD8_RAT NEDD8 OS=Rattus norvegicus OX=10116 GN=Nedd8 PE=1 SV=1
4	F1QMF9	9.64e-48	148	89	0.926	0.843	F1QMF9_DANRE NEDD8 OS=Danio rerio OX=7955 GN=si:zc14a17.5 PE=3 SV=1
5	Q9VJ33	1.94e-46	144	84	0.877	0.845	NEDD8_DROME NEDD8 OS=Drosophila melanogaster OX=7227 GN=Nedd8 PE=1 SV=1
6	Q93725	2.58e-44	139	77	0.827	0.870	NEDD8_CAEEL NEDD8 OS=Caenorhabditis elegans OX=6239 GN=ned-8 PE=1 SV=1
7	Q9SHE7	4.29e-40	130	156	0.802	0.417	RUB1_ARATH Ubiquitin-NEDD8-like protein RUB1 OS=Arabidopsis thaliana OX=3702 GN=RUB1 PE=1 SV=3
8	O14399	3.83e-39	126	78	0.765	0.795	UBL1_SCHPO Ubiquitin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubl1 PE=3 SV=1
9	Q8RUC6	6.43e-39	128	154	0.778	0.409	RUB2_ARATH Ubiquitin-NEDD8-like protein RUB2 OS=Arabidopsis thaliana OX=3702 GN=RUB2 PE=1 SV=3
10	Q5AZV1	5.28e-37	120	81	0.753	0.753	Q5AZV1_EMENI Ubiquitin-like domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06179 PE=4 SV=1
11	Q8ID50	1.22e-27	98.6	128	0.556	0.352	Q8ID50_PLAF7 Ubiquitin-60S ribosomal protein L40 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1365900 PE=1 SV=1
12	J3QS39	6.89e-27	95.5	93	0.543	0.473	J3QS39_HUMAN Ubiquitin B (Fragment) OS=Homo sapiens OX=9606 GN=UBB PE=1 SV=1
13	P18101	1.55e-26	95.9	128	0.543	0.344	RL40_DROME Ubiquitin-ribosomal protein eL40 fusion protein OS=Drosophila melanogaster OX=7227 GN=RpL40 PE=1 SV=2
14	P62984	1.62e-26	95.9	128	0.543	0.344	RL40_MOUSE Ubiquitin-ribosomal protein eL40 fusion protein OS=Mus musculus OX=10090 GN=Uba52 PE=1 SV=2
15	P62986	1.62e-26	95.9	128	0.543	0.344	RL40_RAT Ubiquitin-ribosomal protein eL40 fusion protein OS=Rattus norvegicus OX=10116 GN=Uba52 PE=1 SV=2
16	P62987	1.62e-26	95.9	128	0.543	0.344	RL40_HUMAN Ubiquitin-ribosomal protein eL40 fusion protein OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2
17	P63053	1.62e-26	95.9	128	0.543	0.344	RL40_PIG Ubiquitin-ribosomal protein eL40 fusion protein OS=Sus scrofa OX=9823 GN=UBA52 PE=1 SV=2
18	Q3MIH3	1.62e-26	95.9	128	0.543	0.344	Q3MIH3_HUMAN Ubiquitin-ribosomal protein eL40 fusion protein OS=Homo sapiens OX=9606 GN=UBA52 PE=2 SV=1
19	P62979	2.14e-26	96.3	156	0.543	0.282	RS27A_HUMAN Ubiquitin-ribosomal protein eS31 fusion protein OS=Homo sapiens OX=9606 GN=RPS27A PE=1 SV=2
20	P62992	2.14e-26	96.3	156	0.543	0.282	RS27A_BOVIN Ubiquitin-ribosomal protein eS31 fusion protein OS=Bos taurus OX=9913 GN=RPS27A PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10790 DUF2604	2.4e+02	13.5	Protein of Unknown function (DUF2604)
2	PF11976 Rad60-SLD	3.4e-13	60.5	Ubiquitin-2 like Rad60 SUMO-like
3	PF13881 Rad60-SLD_2	1.1e+02	14.4	Ubiquitin-2 like Rad60 SUMO-like
4	PF18396 TBK1_ULD	0.34	22.1	TANK binding kinase 1 ubiquitin-like domain
5	PF00240 ubiquitin	3.5e-24	95.7	Ubiquitin family
6	PF14560 Ubiquitin_2	0.099	24.5	Ubiquitin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008570540.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008573319.1	0.998	Cullin-1
2	482537.XP_008569270.1	0.997	Sentrin-specific protease 8
3	482537.XP_008577184.1	0.997	NEDD8-conjugating enzyme Ubc12
4	482537.XP_008579592.1	0.997	Cullin-5
5	482537.XP_008574495.1	0.996	COP9 signalosome complex subunit 1
6	482537.XP_008565067.1	0.994	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 1 Protein, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
7	482537.XP_008588313.1	0.992	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 7 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments
8	482537.XP_008586605.1	0.990	Cullin-3
9	482537.XP_008564535.1	0.989	Transcription elongation factor B polypeptide 2
10	482537.XP_008564912.1	0.984	E3 ubiquitin-protein ligase RBX1
11	482537.XP_008577062.1	0.984	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 14 mRNAs, 30 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
12	482537.XP_008570513.1	0.980	Protein KHNYN
13	482537.XP_008572354.1	0.980	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 mRNAs, 12 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 2 samples with support for all annotated introns
14	482537.XP_008566647.1	0.978	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 24 Proteins, and 51% coverage of the annotated genomic feature by RNAseq alignments
15	482537.XP_008577113.1	0.978	Transcription elongation factor B polypeptide 1
16	482537.XP_008571150.1	0.977	cullin-4A
17	482537.XP_008589415.1	0.977	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 2 bases at 2 genomic stop codons
18	482537.XP_008561645.1	0.967	Cullin-2-like
19	482537.XP_008587262.1	0.967	Cullin-2
20	482537.XP_008591208.1	0.967	Cullin-2-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.557	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0006807	0.990	nitrogen compound metabolic process
GO:0043170	0.988	macromolecule metabolic process
GO:0019538	0.983	protein metabolic process
GO:0009987	0.979	cellular process
GO:0070647	0.926	protein modification by small protein conjugation or removal
GO:0050789	0.892	regulation of biological process
GO:0032446	0.856	protein modification by small protein conjugation
GO:0044237	0.830	cellular metabolic process
GO:0050794	0.822	regulation of cellular process
GO:0080090	0.534	regulation of primary metabolic process
GO:0051171	0.534	regulation of nitrogen compound metabolic process
GO:0050896	0.527	response to stimulus
GO:0060255	0.494	regulation of macromolecule metabolic process
GO:0006508	0.486	proteolysis
GO:0044260	0.480	cellular macromolecule metabolic process
GO:0031323	0.366	regulation of cellular metabolic process
GO:0051603	0.329	proteolysis involved in protein catabolic process
GO:0048518	0.320	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.955	nuclear lumen
GO:0005829	0.927	cytosol
GO:0005654	0.872	nucleoplasm
GO:0032991	0.360	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]