StarFunc result for job id Q15848

User Input

>input (244 residues)
MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDG
TPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLE
TYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDK
AMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLY
HDTN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8K660	0.658	0.658	4.334E-36	244	1.000	1.000	A8K660.pdb.gz	A8K660_HUMAN Adiponectin OS=Homo sapiens OX=9606 GN=ADIPOQ PE=1 SV=1
2	AFDB:Q60994	0.633	0.626	8.807E-34	247	0.836	0.826	Q60994.pdb.gz	ADIPO_MOUSE Adiponectin OS=Mus musculus OX=10090 GN=Adipoq PE=1 SV=2
3	AFDB:Q3Y5Z3	0.635	0.645	9.973E-31	240	0.783	0.796	Q3Y5Z3.pdb.gz	ADIPO_BOVIN Adiponectin OS=Bos taurus OX=9913 GN=ADIPOQ PE=1 SV=1
4	AFDB:A0A0G2K845	0.520	0.577	6.473E-22	218	0.689	0.771	A0A0G2K845.pdb.gz	A0A0G2K845_RAT Adiponectin, C1Q and collagen domain containing OS=Rattus norvegicus OX=10116 GN=Adipoq PE=1 SV=1
5	AFDB:Q4ZJN1	0.579	0.430	2.943E-19	333	0.426	0.312	Q4ZJN1.pdb.gz	C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus OX=10090 GN=C1qtnf9 PE=1 SV=1
6	AFDB:B2RNN3	0.611	0.454	1.640E-18	333	0.430	0.315	B2RNN3.pdb.gz	C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens OX=9606 GN=C1QTNF9B PE=1 SV=1
7	AFDB:Q9D8U4	0.538	0.448	4.085E-18	294	0.414	0.344	Q9D8U4.pdb.gz	C1QT2_MOUSE Complement C1q tumor necrosis factor-related protein 2 OS=Mus musculus OX=10090 GN=C1qtnf2 PE=1 SV=1
8	AFDB:A5PN28	0.559	0.285	1.331E-17	489	0.393	0.196	A5PN28.pdb.gz	OTO1A_DANRE Otolin-1-A OS=Danio rerio OX=7955 GN=otol1a PE=1 SV=1
9	AFDB:Q8K479	0.556	0.558	5.092E-17	243	0.393	0.395	Q8K479.pdb.gz	C1QT5_MOUSE Complement C1q tumor necrosis factor-related protein 5 OS=Mus musculus OX=10090 GN=C1qtnf5 PE=1 SV=1
10	AFDB:P08125	0.519	0.190	6.659E-17	674	0.434	0.157	P08125.pdb.gz	COAA1_CHICK Collagen alpha-1(X) chain OS=Gallus gallus OX=9031 GN=COL10A1 PE=1 SV=4
11	PDB:5kc6B	0.461	0.755	1.350E-10	144	0.143	0.243	5kc6B.pdb.gz
12	PDB:5h4bA	0.445	0.766	1.095E-9	136	0.143	0.257	5h4bA.pdb.gz
13	PDB:7e57B	0.304	0.567	1.196E-3	123	0.078	0.154	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
14	PDB:5a3oA	0.270	0.508	9.194E-3	114	0.066	0.140	5a3oA.pdb.gz	Cinnamide Derivatives of D-Mannose as Inhibitors of the Bacterial Virulence Factor Lecb from Pseudomonas Aeruginosa
15	PDB:7l2zF	0.227	0.097	1.269E-2	664	0.037	0.014	7l2zF.pdb.gz
16	PDB:6oj0A	0.274	0.350	1.751E-2	178	0.057	0.079	6oj0A.pdb.gz
17	PDB:7drtB	0.192	0.112	2.290E-2	496	0.061	0.030	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.
18	PDB:4tlgA	0.187	0.123	2.549E-2	396	0.061	0.038	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
19	PDB:2waaA	0.195	0.155	2.995E-2	335	0.053	0.039	2waaA.pdb.gz
20	PDB:1kfxL	0.231	0.106	4.361E-2	640	0.066	0.025	1kfxL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K660	0.0	499	244	1.000	1.000	A8K660_HUMAN Adiponectin OS=Homo sapiens OX=9606 GN=ADIPOQ PE=1 SV=1
2	Q15848	0.0	499	244	1.000	1.000	ADIPO_HUMAN Adiponectin OS=Homo sapiens OX=9606 GN=ADIPOQ PE=1 SV=1
3	Q8K3R4	3.41e-144	404	244	0.795	0.795	Q8K3R4_RAT 30 kDa adipocyte complement-related protein OS=Rattus norvegicus OX=10116 GN=Adipoq PE=1 SV=1
4	Q60994	1.20e-142	401	247	0.791	0.781	ADIPO_MOUSE Adiponectin OS=Mus musculus OX=10090 GN=Adipoq PE=1 SV=2
5	Q3Y5Z3	7.84e-132	373	240	0.730	0.742	ADIPO_BOVIN Adiponectin OS=Bos taurus OX=9913 GN=ADIPOQ PE=1 SV=1
6	A0A0G2K845	1.18e-116	334	218	0.652	0.729	A0A0G2K845_RAT Adiponectin, C1Q and collagen domain containing OS=Rattus norvegicus OX=10116 GN=Adipoq PE=1 SV=1
7	D3ZJ76	4.44e-54	179	331	0.389	0.287	D3ZJ76_RAT C1q and TNF related 9 OS=Rattus norvegicus OX=10116 GN=C1qtnf9 PE=4 SV=3
8	P0C862	1.03e-52	175	333	0.385	0.282	C1T9A_HUMAN Complement C1q and tumor necrosis factor-related protein 9A OS=Homo sapiens OX=9606 GN=C1QTNF9 PE=1 SV=1
9	Q4ZJN1	2.74e-52	174	333	0.381	0.279	C1QT9_MOUSE Complement C1q and tumor necrosis factor-related protein 9 OS=Mus musculus OX=10090 GN=C1qtnf9 PE=1 SV=1
10	B2RNN3	6.01e-52	173	333	0.381	0.279	C1T9B_HUMAN Complement C1q and tumor necrosis factor-related protein 9B OS=Homo sapiens OX=9606 GN=C1QTNF9B PE=1 SV=1
11	Q4ZJM7	2.43e-46	162	482	0.365	0.185	OTOL1_MOUSE Otolin-1 OS=Mus musculus OX=10090 GN=Otol1 PE=1 SV=2
12	Q8BVD7	3.34e-42	147	289	0.385	0.325	C1QT7_MOUSE Complement C1q tumor necrosis factor-related protein 7 OS=Mus musculus OX=10090 GN=C1qtnf7 PE=2 SV=2
13	Q8K479	4.30e-40	140	243	0.389	0.391	C1QT5_MOUSE Complement C1q tumor necrosis factor-related protein 5 OS=Mus musculus OX=10090 GN=C1qtnf5 PE=1 SV=1
14	A5PN28	1.92e-39	144	489	0.373	0.186	OTO1A_DANRE Otolin-1-A OS=Danio rerio OX=7955 GN=otol1a PE=1 SV=1
15	P83371	2.17e-39	144	508	0.340	0.163	OTOL1_ONCKE Otolin-1 OS=Oncorhynchus keta OX=8018 GN=otol1 PE=1 SV=1
16	Q9BXJ0	5.70e-39	137	243	0.373	0.374	C1QT5_HUMAN Complement C1q tumor necrosis factor-related protein 5 OS=Homo sapiens OX=9606 GN=C1QTNF5 PE=1 SV=1
17	Q9D8U4	1.64e-38	137	294	0.361	0.299	C1QT2_MOUSE Complement C1q tumor necrosis factor-related protein 2 OS=Mus musculus OX=10090 GN=C1qtnf2 PE=1 SV=1
18	Q9BXJ5	9.11e-38	135	285	0.357	0.305	C1QT2_HUMAN Complement C1q tumor necrosis factor-related protein 2 OS=Homo sapiens OX=9606 GN=C1QTNF2 PE=1 SV=1
19	P02747	1.57e-37	133	245	0.385	0.384	C1QC_HUMAN Complement C1q subcomponent subunit C OS=Homo sapiens OX=9606 GN=C1QC PE=1 SV=3
20	F1NH19	1.55e-36	131	244	0.340	0.340	F1NH19_CHICK Complement C1q B chain OS=Gallus gallus OX=9031 GN=C1QB PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18573 BclA_C	51	15.2	BclA C-terminal domain
2	PF00386 C1q	2.9e-38	142.3	C1q domain
3	PF01391 Collagen	6.4e-07	40.3	Collagen triple helix repeat (20 copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000389814

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000341785	0.998	Adiponectin receptor protein 1
2	9606.ENSP00000349616	0.998	Adiponectin receptor protein 2
3	9606.ENSP00000268613	0.992	Cadherin-13
4	9606.ENSP00000287820	0.989	Peroxisome proliferator-activated receptor gamma
5	9606.ENSP00000427514	0.979	CCAAT/enhancer-binding protein alpha
6	9606.ENSP00000264867	0.973	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
7	9606.ENSP00000262455	0.966	Endoplasmic reticulum resident protein 44
8	9606.ENSP00000305422	0.961	CCAAT/enhancer-binding protein beta
9	9606.ENSP00000320866	0.957	Calreticulin
10	9606.ENSP00000320886	0.949	Carbohydrate-responsive element-binding protein
11	9606.ENSP00000231509	0.939	Glucocorticoid receptor
12	9606.ENSP00000288266	0.939	DCC-interacting protein 13-alpha
13	9606.ENSP00000221515	0.935	Resistin
14	9606.ENSP00000312652	0.932	Leptin
15	9606.ENSP00000419692	0.928	Retinoic acid receptor RXR-alpha
16	9606.ENSP00000380432	0.922	Insulin
17	9606.ENSP00000399968	0.921	Nuclear receptor coactivator 2
18	9606.ENSP00000263253	0.917	Histone acetyltransferase p300
19	9606.ENSP00000300651	0.916	Mediator of RNA polymerase II transcription subunit 1
20	9606.ENSP00000262367	0.914	CREB-binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0042802	0.981	identical protein binding
GO:0005102	0.460	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0048518	0.995	positive regulation of biological process
GO:0050896	0.992	response to stimulus
GO:0048522	0.991	positive regulation of cellular process
GO:0009987	0.990	cellular process
GO:0001932	0.987	regulation of protein phosphorylation
GO:0065009	0.986	regulation of molecular function
GO:0032879	0.985	regulation of localization
GO:0051241	0.984	negative regulation of multicellular organismal process
GO:0051049	0.983	regulation of transport
GO:0042327	0.982	positive regulation of phosphorylation
GO:0051338	0.978	regulation of transferase activity
GO:0065008	0.976	regulation of biological quality
GO:0048523	0.976	negative regulation of cellular process
GO:0009892	0.976	negative regulation of metabolic process
GO:0023051	0.975	regulation of signaling
GO:0010646	0.975	regulation of cell communication
GO:0048583	0.970	regulation of response to stimulus
GO:0010604	0.969	positive regulation of macromolecule metabolic process
GO:0051716	0.965	cellular response to stimulus
GO:0071704	0.964	organic substance metabolic process
GO:0044093	0.960	positive regulation of molecular function
GO:0001934	0.958	positive regulation of protein phosphorylation
GO:0045598	0.956	regulation of fat cell differentiation
GO:0044238	0.955	primary metabolic process
GO:0043085	0.954	positive regulation of catalytic activity
GO:0051051	0.949	negative regulation of transport
GO:0045599	0.939	negative regulation of fat cell differentiation
GO:0043549	0.939	regulation of kinase activity
GO:0010648	0.930	negative regulation of cell communication
GO:0062012	0.929	regulation of small molecule metabolic process
GO:0023057	0.929	negative regulation of signaling
GO:0010468	0.918	regulation of gene expression
GO:0031324	0.914	negative regulation of cellular metabolic process
GO:0009889	0.912	regulation of biosynthetic process
GO:0042221	0.911	response to chemical
GO:0051347	0.911	positive regulation of transferase activity
GO:0045859	0.909	regulation of protein kinase activity
GO:0051050	0.901	positive regulation of transport
GO:0045860	0.879	positive regulation of protein kinase activity
GO:0044237	0.876	cellular metabolic process
GO:0006109	0.875	regulation of carbohydrate metabolic process
GO:0009966	0.874	regulation of signal transduction
GO:0010033	0.872	response to organic substance
GO:0032501	0.867	multicellular organismal process
GO:0031326	0.866	regulation of cellular biosynthetic process
GO:1902531	0.861	regulation of intracellular signal transduction
GO:0051240	0.858	positive regulation of multicellular organismal process
GO:0010605	0.851	negative regulation of macromolecule metabolic process
GO:0009719	0.834	response to endogenous stimulus
GO:0010817	0.830	regulation of hormone levels
GO:1903530	0.826	regulation of secretion by cell
GO:0051128	0.821	regulation of cellular component organization
GO:0010675	0.817	regulation of cellular carbohydrate metabolic process
GO:1901700	0.813	response to oxygen-containing compound
GO:0048585	0.812	negative regulation of response to stimulus
GO:0042127	0.811	regulation of cell population proliferation
GO:0046883	0.810	regulation of hormone secretion
GO:0070887	0.784	cellular response to chemical stimulus
GO:0002682	0.783	regulation of immune system process
GO:0010647	0.764	positive regulation of cell communication
GO:0023056	0.759	positive regulation of signaling
GO:0010556	0.724	regulation of macromolecule biosynthetic process
GO:0071310	0.711	cellular response to organic substance
GO:0048584	0.709	positive regulation of response to stimulus
GO:0044092	0.707	negative regulation of molecular function
GO:0071495	0.705	cellular response to endogenous stimulus
GO:0051179	0.701	localization
GO:0006355	0.686	regulation of DNA-templated transcription
GO:0009605	0.655	response to external stimulus
GO:0009890	0.627	negative regulation of biosynthetic process
GO:1901701	0.622	cellular response to oxygen-containing compound
GO:0009968	0.619	negative regulation of signal transduction
GO:0009967	0.605	positive regulation of signal transduction
GO:0032101	0.599	regulation of response to external stimulus
GO:0033036	0.596	macromolecule localization
GO:0080134	0.596	regulation of response to stress
GO:0051172	0.588	negative regulation of nitrogen compound metabolic process
GO:0009725	0.562	response to hormone
GO:0051048	0.562	negative regulation of secretion
GO:0032102	0.560	negative regulation of response to external stimulus
GO:0006950	0.548	response to stress
GO:0044281	0.537	small molecule metabolic process
GO:0007154	0.534	cell communication
GO:0010906	0.518	regulation of glucose metabolic process
GO:0043408	0.509	regulation of MAPK cascade
GO:1901653	0.499	cellular response to peptide
GO:0070727	0.486	cellular macromolecule localization
GO:0023052	0.476	signaling
GO:0031327	0.471	negative regulation of cellular biosynthetic process
GO:0032870	0.469	cellular response to hormone stimulus
GO:0007165	0.466	signal transduction
GO:0043255	0.462	regulation of carbohydrate biosynthetic process
GO:0032502	0.453	developmental process
GO:0071375	0.427	cellular response to peptide hormone stimulus
GO:0032869	0.384	cellular response to insulin stimulus
GO:0048856	0.378	anatomical structure development
GO:0006807	0.378	nitrogen compound metabolic process
GO:1902532	0.370	negative regulation of intracellular signal transduction
GO:0009743	0.315	response to carbohydrate
GO:0071840	0.311	cellular component organization or biogenesis
GO:0009891	0.310	positive regulation of biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0071944	0.943	cell periphery
GO:0043231	0.820	intracellular membrane-bounded organelle
GO:0005737	0.750	cytoplasm
GO:0062023	0.621	collagen-containing extracellular matrix
GO:0032991	0.482	protein-containing complex
GO:0070013	0.480	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]