StarFunc result for job id Q15853

User Input

>input (346 residues)
MDMLDPGLDPAASATAAAAASHDKGPEAEEGVELQEGGDGPGAEEQTAVAITSVQQAAFG
DHNIQYQFRTETNGGQVTYRVVQVTDGQLDGQGDTAGAVSVVSTAAFAGGQQAVTQVGVD
GAAQRPGPAAASVPPGPAAPFPLAVIQNPFSNGGSPAAEAVSGEARFAYFPASSVGDTTA
VSVQTTDQSLQAGGQFYVMMTPQDVLQTGTQRTIAPRTHPYSPKIDGTRTPRDERRRAQH
NEVERRRRDKINNWIVQLSKIIPDCNADNSKTGASKGGILSKACDYIRELRQTNQRMQET
FKEAERLQMDNELLRQQIEELKNENALLRAQLQQHNLEMVGEGTRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63665	0.730	0.730	8.393E-46	346	0.980	0.980	Q63665.pdb.gz	USF2_RAT Upstream stimulatory factor 2 OS=Rattus norvegicus OX=10116 GN=Usf2 PE=1 SV=2
2	AFDB:B4DLJ1	0.307	0.305	5.936E-40	349	0.910	0.903	B4DLJ1.pdb.gz	B4DLJ1_HUMAN Upstream transcription factor 2, c-fos interacting OS=Homo sapiens OX=9606 GN=USF2 PE=1 SV=1
3	AFDB:A0A060KY90	0.149	0.087	8.255E-4	630	0.171	0.094	A0A060KY90.pdb.gz	MYC1_SOLLC Transcription factor MYC1 OS=Solanum lycopersicum OX=4081 GN=MYC1 PE=1 SV=1
4	AFDB:P36956	0.173	0.055	2.842E-3	1147	0.208	0.063	P36956.pdb.gz	SRBP1_HUMAN Sterol regulatory element-binding protein 1 OS=Homo sapiens OX=9606 GN=SREBF1 PE=1 SV=2
5	AFDB:A0A0C4DG26	0.204	0.100	9.168E-3	721	0.171	0.082	A0A0C4DG26.pdb.gz	A0A0C4DG26_HUMAN HCG18989, isoform CRA_h OS=Homo sapiens OX=9606 GN=MLXIPL PE=1 SV=1
6	AFDB:U3JAG9	0.144	0.053	1.355E-2	1113	0.171	0.053	U3JAG9.pdb.gz	CP131_DANRE Centrosomal protein of 131 kDa OS=Danio rerio OX=7955 GN=cep131 PE=1 SV=1
7	AFDB:P04198	0.217	0.166	1.647E-2	464	0.194	0.144	P04198.pdb.gz	MYCN_HUMAN N-myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYCN PE=1 SV=2
8	AFDB:Q9NP71	0.191	0.081	1.647E-2	852	0.199	0.081	Q9NP71.pdb.gz	MLXPL_HUMAN Carbohydrate-responsive element-binding protein OS=Homo sapiens OX=9606 GN=MLXIPL PE=1 SV=1
9	AFDB:Q8VIP2	0.191	0.080	2.771E-2	865	0.182	0.073	Q8VIP2.pdb.gz	MLXPL_RAT Carbohydrate-responsive element-binding protein OS=Rattus norvegicus OX=10116 GN=Mlxipl PE=1 SV=1
10	AFDB:F4I9R1	0.156	0.145	3.156E-2	374	0.145	0.134	F4I9R1.pdb.gz	F4I9R1_ARATH Basic-leucine zipper (BZIP) transcription factor family protein OS=Arabidopsis thaliana OX=3702 GN=At1g58110 PE=1 SV=1
11	PDB:2k8pA	0.083	0.133	1.198	189	0.078	0.143	2k8pA.pdb.gz
12	PDB:5b0vA	0.063	0.083	1.890	258	0.020	0.027	5b0vA.pdb.gz
13	PDB:6fecU	0.059	0.100	2.152	191	0.012	0.021	6fecU.pdb.gz	Structure of a human cap-dependent 48S translation pre-initiation complex.
14	PDB:2bskD	0.106	0.299	2.616	90	0.023	0.089	2bskD.pdb.gz
15	PDB:3ojaA	0.229	0.172	2.616	482	0.052	0.037	3ojaA.pdb.gz	A heterodimeric complex of the LRR proteins LRIM1 and APL1C regulates complement-like immunity in Anopheles gambiae.
16	PDB:5mrcPP	0.065	0.167	2.792	116	0.006	0.017	5mrcPP.pdb.gz	The structure of the yeast mitochondrial ribosome.
17	PDB:6h68M	0.078	0.071	3.180	396	0.012	0.010	6h68M.pdb.gz	Structural basis of RNA polymerase I stalling at UV light-induced DNA damage.
18	PDB:7m8eF	0.052	0.020	3.394	967	0.014	0.005	7m8eF.pdb.gz	Structural basis for activation of Swi2/Snf2 ATPase RapA by RNA polymerase.
19	PDB:4iluA	0.052	0.105	4.699	165	0.020	0.042	4iluA.pdb.gz
20	PDB:4v8mA2	0.060	0.106	4.699	187	0.014	0.027	4v8mA2.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B4DLJ1	0.0	643	349	0.910	0.903	B4DLJ1_HUMAN Upstream transcription factor 2, c-fos interacting OS=Homo sapiens OX=9606 GN=USF2 PE=1 SV=1
2	Q15853	0.0	707	346	1.000	1.000	USF2_HUMAN Upstream stimulatory factor 2 OS=Homo sapiens OX=9606 GN=USF2 PE=1 SV=1
3	Q63665	0.0	694	346	0.980	0.980	USF2_RAT Upstream stimulatory factor 2 OS=Rattus norvegicus OX=10116 GN=Usf2 PE=1 SV=2
4	Q64705	0.0	694	346	0.980	0.980	USF2_MOUSE Upstream stimulatory factor 2 OS=Mus musculus OX=10090 GN=Usf2 PE=1 SV=1
5	M0QXT0	1.93e-139	397	253	0.584	0.798	M0QXT0_HUMAN Upstream transcription factor 2, c-fos interacting (Fragment) OS=Homo sapiens OX=9606 GN=USF2 PE=1 SV=2
6	B1AQP1	5.54e-107	316	282	0.488	0.599	B1AQP1_HUMAN Upstream transcription factor 1 OS=Homo sapiens OX=9606 GN=USF1 PE=1 SV=1
7	A0A0S2Z4U5	2.66e-105	313	310	0.497	0.555	A0A0S2Z4U5_HUMAN Upstream transcription factor 1 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=USF1 PE=2 SV=1
8	P22415	2.66e-105	313	310	0.497	0.555	USF1_HUMAN Upstream stimulatory factor 1 OS=Homo sapiens OX=9606 GN=USF1 PE=1 SV=1
9	Q61069	8.35e-105	311	310	0.491	0.548	USF1_MOUSE Upstream stimulatory factor 1 OS=Mus musculus OX=10090 GN=Usf1 PE=1 SV=1
10	M0R1C6	2.58e-87	261	143	0.376	0.909	M0R1C6_HUMAN Upstream transcription factor 2, c-fos interacting (Fragment) OS=Homo sapiens OX=9606 GN=USF2 PE=1 SV=1
11	M0QY46	4.34e-82	248	170	0.399	0.812	M0QY46_HUMAN Upstream transcription factor 2, c-fos interacting (Fragment) OS=Homo sapiens OX=9606 GN=USF2 PE=1 SV=1
12	E9PME6	1.06e-62	201	217	0.251	0.401	E9PME6_HUMAN Upstream transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=USF1 PE=1 SV=8
13	Q9W4J8	2.93e-14	75.5	437	0.124	0.098	Q9W4J8_DROME FI24210p1 OS=Drosophila melanogaster OX=7227 GN=Usf PE=2 SV=1
14	B0QYS6	2.35e-10	63.9	490	0.092	0.065	B0QYS6_HUMAN Transcription factor EB OS=Homo sapiens OX=9606 GN=TFEB PE=1 SV=1
15	Q9R210	2.38e-10	63.9	475	0.092	0.067	TFEB_MOUSE Transcription factor EB OS=Mus musculus OX=10090 GN=Tfeb PE=1 SV=2
16	P19484	3.01e-10	63.5	476	0.092	0.067	TFEB_HUMAN Transcription factor EB OS=Homo sapiens OX=9606 GN=TFEB PE=1 SV=3
17	B0QYS7	3.22e-10	63.5	562	0.092	0.057	B0QYS7_HUMAN Transcription factor EB OS=Homo sapiens OX=9606 GN=TFEB PE=1 SV=1
18	H2KZZ2	9.57e-10	62.0	524	0.098	0.065	HLH30_CAEEL Helix-loop-helix protein 30 OS=Caenorhabditis elegans OX=6239 GN=hlh-30 PE=1 SV=1
19	Q9PWC2	1.36e-09	61.2	412	0.092	0.078	Q9PWC2_DANRE Melanocyte-inducing transcription factor a OS=Danio rerio OX=7955 GN=nacre PE=2 SV=1
20	Q7JQK3	1.38e-09	60.8	348	0.101	0.101	Q7JQK3_DROME RH36157p OS=Drosophila melanogaster OX=7227 GN=Usf PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09789 CC149	12	16.7	Coiled-coil domain-containing protein 149-A
2	PF09873 DUF2100	1.5e+02	13.6	Uncharacterized protein conserved in archaea (DUF2100)
3	PF00010 HLH	1.5e-13	61.8	Helix-loop-helix DNA-binding domain
4	PF18052 Rx_N	1.8e+02	13.8	Rx N-terminal domain
5	PF06785 UPF0242	2.1e+02	13.4	Uncharacterised protein family (UPF0242) N-terminus
6	PF06156 YabA	1e+02	15.0	Initiation control protein YabA

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000222305

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357000	0.977	Upstream stimulatory factor 1
2	9606.ENSP00000310170	0.968	Fos-related antigen 1
3	9606.ENSP00000263253	0.913	Histone acetyltransferase p300
4	9606.ENSP00000236671	0.910	Cathepsin D
5	9606.ENSP00000329357	0.901	Transcription factor Sp1
6	9606.ENSP00000261890	0.870	Ras-related protein Rab-11A
7	9606.ENSP00000300651	0.800	Mediator of RNA polymerase II transcription subunit 1
8	9606.ENSP00000344903	0.778	Transcription factor MafK
9	9606.ENSP00000418960	0.771	Breast cancer type 1 susceptibility protein
10	9606.ENSP00000250448	0.732	Hepatocyte nuclear factor 3-alpha
11	9606.ENSP00000422554	0.723	A disintegrin and metalloproteinase with thrombospondin motifs 12
12	9606.ENSP00000460070	0.715	General transcription factor II-I
13	9606.ENSP00000405330	0.675	Estrogen receptor
14	9606.ENSP00000263734	0.670	Endothelial PAS domain-containing protein 1
15	9606.ENSP00000439120	0.670	Transcription factor NF-E2 45 kDa subunit
16	9606.ENSP00000304592	0.664	Fatty acid synthase
17	9606.ENSP00000360532	0.664	Cell division cycle 5-like protein
18	9606.ENSP00000385216	0.661	Nuclear receptor coactivator 1
19	9606.ENSP00000399968	0.649	Nuclear receptor coactivator 2
20	9606.ENSP00000262238	0.645	Transcriptional repressor protein YY1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.996	transcription cis-regulatory region binding
GO:0000978	0.988	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0044877	0.874	protein-containing complex binding
GO:0008134	0.435	transcription factor binding
GO:0140297	0.428	DNA-binding transcription factor binding
GO:0043425	0.341	bHLH transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.995	regulation of macromolecule metabolic process
GO:0019219	0.995	regulation of nucleobase-containing compound metabolic process
GO:0045893	0.990	positive regulation of DNA-templated transcription
GO:0006357	0.987	regulation of transcription by RNA polymerase II
GO:0045944	0.963	positive regulation of transcription by RNA polymerase II
GO:0009987	0.901	cellular process
GO:0050896	0.731	response to stimulus
GO:0051716	0.678	cellular response to stimulus
GO:0042221	0.509	response to chemical
GO:0007154	0.500	cell communication
GO:0048519	0.380	negative regulation of biological process
GO:0070887	0.360	cellular response to chemical stimulus
GO:0031669	0.307	cellular response to nutrient levels

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.995	nucleoplasm
GO:0032991	0.679	protein-containing complex
GO:0005737	0.343	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]