StarFunc result for job id Q15858

User Input

>input (1988 residues)
MAMLPPPGPQSFVHFTKQSLALIEQRIAERKSKEPKEEKKDDDEEAPKPSSDLEAGKQLP
FIYGDIPPGMVSEPLEDLDPYYADKKTFIVLNKGKTIFRFNATPALYMLSPFSPLRRISI
KILVHSLFSMLIMCTILTNCIFMTMNNPPDWTKNVEYTFTGIYTFESLVKILARGFCVGE
FTFLRDPWNWLDFVVIVFAYLTEFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQ
SVKKLSDVMILTVFCLSVFALIGLQLFMGNLKHKCFRNSLENNETLESIMNTLESEEDFR
KYFYYLEGSKDALLCGFSTDSGQCPEGYTCVKIGRNPDYGYTSFDTFSWAFLALFRLMTQ
DYWENLYQQTLRAAGKTYMIFFVVVIFLGSFYLINLILAVVAMAYEEQNQANIEEAKQKE
LEFQQMLDRLKKEQEEAEAIAAAAAEYTSIRRSRIMGLSESSSETSKLSSKSAKERRNRR
KKKNQKKLSSGEEKGDAEKLSKSESEDSIRRKSFHLGVEGHRRAHEKRLSTPNQSPLSIR
GSLFSARRSSRTSLFSFKGRGRDIGSETEFADDEHSIFGDNESRRGSLFVPHRPQERRSS
NISQASRSPPMLPVNGKMHSAVDCNGVVSLVDGRSALMLPNGQLLPEVIIDKATSDDSGT
TNQIHKKRRCSSYLLSEDMLNDPNLRQRAMSRASILTNTVEELEESRQKCPPWWYRFAHK
FLIWNCSPYWIKFKKCIYFIVMDPFVDLAITICIVLNTLFMAMEHHPMTEEFKNVLAIGN
LVFTGIFAAEMVLKLIAMDPYEYFQVGWNIFDSLIVTLSLVELFLADVEGLSVLRSFRLL
RVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKIN
DDCTLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVYMMVMVIGNLVVL
NLFLALLLSSFSSDNLTAIEEDPDANNLQIAVTRIKKGINYVKQTLREFILKAFSKKPKI
SREIRQAEDLNTKKENYISNHTLAEMSKGHNFLKEKDKISGFGSSVDKHLMEDSDGQSFI
HNPSLTVTVPIAPGESDLENMNAEELSSDSDSEYSKVRLNRSSSSECSTVDNPLPGEGEE
AEAEPMNSDEPEACFTDGCVWRFSCCQVNIESGKGKIWWNIRKTCYKIVEHSWFESFIVL
MILLSSGALAFEDIYIERKKTIKIILEYADKIFTYIFILEMLLKWIAYGYKTYFTNAWCW
LDFLIVDVSLVTLVANTLGYSDLGPIKSLRTLRALRPLRALSRFEGMRVVVNALIGAIPS
IMNVLLVCLIFWLIFSIMGVNLFAGKFYECINTTDGSRFPASQVPNRSECFALMNVSQNV
RWKNLKVNFDNVGLGYLSLLQVATFKGWTIIMYAAVDSVNVDKQPKYEYSLYMYIYFVVF
IIFGSFFTLNLFIGVIIDNFNQQKKKLGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRP
GNKIQGCIFDLVTNQAFDISIMVLICLNMVTMMVEKEGQSQHMTEVLYWINVVFIILFTG
ECVLKLISLRHYYFTVGWNIFDFVVVIISIVGMFLADLIETYFVSPTLFRVIRLARIGRI
LRLVKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKKEDGINDMFN
FETFGNSMICLFQITTSAGWDGLLAPILNSKPPDCDPKKVHPGSSVEGDCGNPSVGIFYF
VSYIIISFLVVVNMYIAVILENFSVATEESTEPLSEDDFEMFYEVWEKFDPDATQFIEFS
KLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDSLR
SQMEERFMSANPSKVSYEPITTTLKRKQEDVSATVIQRAYRRYRLRQNVKNISSIYIKDG
DRDDDLLNKKDMAFDNVNENSSPEKTDATSSTTSPPSYDSVTKPDKEKYEQDRTEKEDKG
KDSKESKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6agfA	0.565	0.982	0.000	1138	0.472	0.824	6agfA.pdb.gz	Structure of the human voltage-gated sodium channel Nav1.4 in complex with beta 1.
2	PDB:6j8eA	0.565	0.981	0.000	1139	0.490	0.856	6j8eA.pdb.gz	Molecular basis for pore blockade of human Na+channel Nav1.2 by the mu-conotoxin KIIIA.
3	PDB:6j8gA	0.568	0.986	0.000	1140	0.572	0.998	6j8gA.pdb.gz	Structures of human Nav1.7 channel in complex with auxiliary subunits and animal toxins.
4	PDB:7w9lA	0.654	0.911	0.000	1420	0.713	0.999	7w9lA.pdb.gz	High-resolution structures of human Na v 1.7 reveal gating modulation through alpha-pi helical transition of S6 IV.
5	PDB:7xveA	0.601	0.919	0.000	1276	0.635	0.989	7xveA.pdb.gz	Unwinding and spiral sliding of S4 and domain rotation of VSD during the electromechanical coupling in Na v 1.7.
6	AFDB:A0A0R4IUM7	0.800	0.813	0.000	1955	0.655	0.666	A0A0R4IUM7.pdb.gz	A0A0R4IUM7_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=Nav1.1 PE=3 SV=2
7	AFDB:A2APX8	0.855	0.846	0.000	2009	0.774	0.766	A2APX8.pdb.gz	SCN1A_MOUSE Sodium channel protein type 1 subunit alpha OS=Mus musculus OX=10090 GN=Scn1a PE=1 SV=1
8	AFDB:B1AWN6	0.830	0.822	0.000	2006	0.789	0.782	B1AWN6.pdb.gz	SCN2A_MOUSE Sodium channel protein type 2 subunit alpha OS=Mus musculus OX=10090 GN=Scn2a PE=1 SV=1
9	AFDB:F1QXF5	0.828	0.824	0.000	1996	0.736	0.733	F1QXF5.pdb.gz	F1QXF5_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn1lab PE=3 SV=1
10	AFDB:P08104	0.838	0.853	0.000	1951	0.749	0.764	P08104.pdb.gz	SCN3A_RAT Sodium channel protein type 3 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn3a PE=1 SV=1
11	AFDB:P15389	0.793	0.781	0.000	2019	0.625	0.615	P15389.pdb.gz	SCN5A_RAT Sodium channel protein type 5 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn5a PE=1 SV=1
12	AFDB:Q15858	1.000	1.000	0.000	1988	1.000	1.000	Q15858.pdb.gz	SCN9A_HUMAN Sodium channel protein type 9 subunit alpha OS=Homo sapiens OX=9606 GN=SCN9A PE=1 SV=3
13	AFDB:Q6QIY3	0.763	0.775	0.000	1958	0.549	0.558	Q6QIY3.pdb.gz	SCNAA_MOUSE Sodium channel protein type 10 subunit alpha OS=Mus musculus OX=10090 GN=Scn10a PE=1 SV=2
14	AFDB:Q9ER60	0.765	0.825	0.000	1841	0.629	0.680	Q9ER60.pdb.gz	SCN4A_MOUSE Sodium channel protein type 4 subunit alpha OS=Mus musculus OX=10090 GN=Scn4a PE=1 SV=1
15	AFDB:Q9UQD0	0.817	0.821	0.000	1980	0.712	0.715	Q9UQD0.pdb.gz	SCN8A_HUMAN Sodium channel protein type 8 subunit alpha OS=Homo sapiens OX=9606 GN=SCN8A PE=1 SV=1
16	PDB:7we4A	0.547	0.960	2.935E-99	1122	0.390	0.692	7we4A.pdb.gz	Structural basis for high-voltage activation and subtype-specific inhibition of human Na v 1.8.
17	PDB:6lqaB	0.561	0.961	2.981E-98	1151	0.441	0.762	6lqaB.pdb.gz	Structural Basis for Pore Blockade of the Human Cardiac Sodium Channel Na v 1.5 by the Antiarrhythmic Drug Quinidine*.
18	PDB:6uz3A	0.551	0.965	1.552E-95	1126	0.436	0.770	6uz3A.pdb.gz	Structure of the Cardiac Sodium Channel.
19	PDB:7tj9A	0.538	0.954	1.319E-83	1111	0.329	0.590	7tj9A.pdb.gz	Structure-guided unlocking of Na X reveals a non-selective tetrodotoxin-sensitive cation channel.
20	PDB:7mixA	0.539	0.793	1.909E-51	1326	0.197	0.295	7mixA.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MT39	2363	1962	0.621	0.629	A0A0A0MT39_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
2	A0A0R4IUM7	2511	1955	0.650	0.661	A0A0R4IUM7_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=Nav1.1 PE=3 SV=2
3	A0A1B0GVX7	2343	1618	0.606	0.745	A0A1B0GVX7_HUMAN Sodium voltage-gated channel alpha subunit 1 OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
4	A0A1W2PPJ3	2988	1998	0.767	0.763	A0A1W2PPJ3_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
5	A0A286YEQ8	1886	1915	0.501	0.520	A0A286YEQ8_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
6	A0A286YF26	2991	1997	0.768	0.765	A0A286YF26_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
7	A0A590UK43	2610	1939	0.690	0.708	A0A590UK43_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN8A PE=1 SV=1
8	A0A8I6GH51	1270	1672	0.330	0.393	A0A8I6GH51_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=3 SV=1
9	A2APX8	3027	2009	0.775	0.767	SCN1A_MOUSE Sodium channel protein type 1 subunit alpha OS=Mus musculus OX=10090 GN=Scn1a PE=1 SV=1
10	A2ASI5	2794	1947	0.740	0.756	SCN3A_MOUSE Sodium channel protein type 3 subunit alpha OS=Mus musculus OX=10090 GN=Scn3a PE=1 SV=1
11	B1AWN6	3084	2006	0.790	0.783	SCN2A_MOUSE Sodium channel protein type 2 subunit alpha OS=Mus musculus OX=10090 GN=Scn2a PE=1 SV=1
12	B1AYL1	1322	1681	0.344	0.406	B1AYL1_MOUSE Sodium channel protein OS=Mus musculus OX=10090 GN=Scn7a PE=1 SV=1
13	E9PG18	1134	1998	0.307	0.306	E9PG18_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
14	E9PHB6	1135	1983	0.307	0.308	E9PHB6_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
15	F1LQQ7	1284	1680	0.337	0.399	F1LQQ7_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=1 SV=4
16	F1QXF5	2869	1996	0.737	0.734	F1QXF5_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn1lab PE=3 SV=1
17	H9KVD2	1135	2016	0.307	0.303	H9KVD2_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
18	K4DIA1	2362	1962	0.620	0.628	K4DIA1_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
19	O08562	3613	1984	0.930	0.931	SCN9A_RAT Sodium channel protein type 9 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn9a PE=1 SV=1
20	O88420	2695	1978	0.711	0.715	SCN8A_RAT Sodium channel protein type 8 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn8a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16905 GPHH	0.93	20.8	Voltage-dependent L-type calcium channel, IQ-associated
2	PF00520 Ion_trans	6.9e-255	852.5	Ion transport protein
3	PF00612 IQ	13	16.9	IQ calmodulin-binding motif
4	PF14625 Lustrin_cystein	1.1e+02	14.6	Lustrin, cysteine-rich repeated domain
5	PF06512 Na_trans_assoc	2.7e-54	196.1	Sodium ion transport-associated
6	PF11933 Na_trans_cytopl	2.1e-57	205.5	Cytoplasmic domain of voltage-gated Na+ ion channel
7	PF08016 PKD_channel	3.3e-06	38.2	Polycystin cation channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000004215

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000003760	0.977	Sodium channel protein
2	61853.ENSNLEP00000003865	0.977	Sodium channel protein
3	61853.ENSNLEP00000008973	0.968	Sodium channel, voltage-gated, type II, beta subunit
4	61853.ENSNLEP00000004136	0.920	Sodium channel protein
5	61853.ENSNLEP00000021576	0.890	Sodium channel protein
6	61853.ENSNLEP00000008788	0.859	Glutamate receptor, ionotropic, AMPA 4
7	61853.ENSNLEP00000009043	0.827	Sodium channel, voltage-gated, type III, beta subunit
8	61853.ENSNLEP00000006601	0.813	Sodium channel protein
9	61853.ENSNLEP00000008971	0.812	Sodium channel, voltage-gated, type IV, beta subunit
10	61853.ENSNLEP00000014651	0.801	Sodium channel, non-voltage-gated 1, beta subunit
11	61853.ENSNLEP00000018523	0.801	Calcium homeostasis modulator 1
12	61853.ENSNLEP00000020913	0.778	Unc-79 homolog, NALCN channel complex subunit
13	61853.ENSNLEP00000003662	0.771	Fibroblast growth factor 13
14	61853.ENSNLEP00000013309	0.760	Sodium channel, voltage-gated, type I, beta subunit
15	61853.ENSNLEP00000006092	0.716	Transient receptor potential cation channel, subfamily M, member 4
16	61853.ENSNLEP00000004129	0.702	Glutamate receptor, ionotropic, kainate 1
17	61853.ENSNLEP00000017072	0.700	Glutamate receptor, ionotropic, kainate 2
18	61853.ENSNLEP00000009029	0.698	Glutamate receptor, ionotropic, kainate 4
19	61853.ENSNLEP00000023365	0.697	Uncharacterized protein
20	61853.ENSNLEP00000016670	0.695	Cyclic nucleotide gated channel alpha 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005248	1.000	voltage-gated sodium channel activity
GO:0005515	0.992	protein binding
GO:0022836	0.479	gated channel activity
GO:0022839	0.457	monoatomic ion gated channel activity
GO:0005244	0.415	voltage-gated monoatomic ion channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0032501	0.988	multicellular organismal process
GO:0065007	0.976	biological regulation
GO:0051179	0.975	localization
GO:0006811	0.969	monoatomic ion transport
GO:0030001	0.962	metal ion transport
GO:0050896	0.939	response to stimulus
GO:0003008	0.939	system process
GO:0006814	0.930	sodium ion transport
GO:0034220	0.913	monoatomic ion transmembrane transport
GO:0019233	0.897	sensory perception of pain
GO:0098660	0.883	inorganic ion transmembrane transport
GO:0042391	0.878	regulation of membrane potential
GO:0001508	0.844	action potential
GO:0098655	0.803	monoatomic cation transmembrane transport
GO:0098662	0.765	inorganic cation transmembrane transport
GO:0007154	0.723	cell communication
GO:0050789	0.709	regulation of biological process
GO:0048265	0.678	response to pain
GO:0019226	0.623	transmission of nerve impulse
GO:0009628	0.534	response to abiotic stimulus
GO:0050794	0.520	regulation of cellular process
GO:0042221	0.475	response to chemical
GO:0032502	0.388	developmental process
GO:0035725	0.381	sodium ion transmembrane transport
GO:0007610	0.358	behavior
GO:0051716	0.358	cellular response to stimulus
GO:0048856	0.345	anatomical structure development
GO:0023052	0.313	signaling

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.949	protein-containing complex
GO:0098797	0.852	plasma membrane protein complex
GO:1990351	0.845	transporter complex
GO:0034703	0.840	cation channel complex
GO:0005622	0.690	intracellular anatomical structure
GO:0034706	0.663	sodium channel complex
GO:0001518	0.615	voltage-gated sodium channel complex
GO:0043227	0.602	membrane-bounded organelle
GO:0043231	0.566	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]