StarFunc result for job id Q15878

User Input

>input (2313 residues)
MARFGEAVVARPGSGDGDSDQSRNRQGTPVPASGQAAAYKQTKAQRARTMALYNPIPVRQ
NCFTVNRSLFIFGEDNIVRKYAKKLIDWPPFEYMILATIIANCIVLALEQHLPEDDKTPM
SRRLEKTEPYFIGIFCFEAGIKIVALGFIFHKGSYLRNGWNVMDFIVVLSGILATAGTHF
NTHVDLRTLRAVRVLRPLKLVSGIPSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGL
EFYSGKLHRACFMNNSGILEGFDPPHPCGVQGCPAGYECKDWIGPNDGITQFDNILFAVL
TVFQCITMEGWTTVLYNTNDALGATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERER
VENRRAFMKLRRQQQIERELNGYRAWIDKAEEVMLAEENKNAGTSALEVLRRATIKRSRT
EAMTRDSSDEHCVDISSVGTPLARASIKSAKVDGVSYFRHKERLLRISIRHMVKSQVFYW
IVLSLVALNTACVAIVHHNQPQWLTHLLYYAEFLFLGLFLLEMSLKMYGMGPRLYFHSSF
NCFDFGVTVGSIFEVVWAIFRPGTSFGISVLRALRLLRIFKITKYWASLRNLVVSLMSSM
KSIISLLFLLFLFIVVFALLGMQLFGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWN
EVMYNGIRSQGGVSSGMWSAIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEE
EAFNQKHALQKAKEVSPMSAPNMPSIERDRRRRHHMSMWEPRSSHLRERRRRHHMSVWEQ
RTSQLRKHMQMSSQEALNREEAPTMNPLNPLNPLSSLNPLNAHPSLYRRPRAIEGLALGL
ALEKFEEERISRGGSLKGDGGDRSSALDNQRTPLSLGQREPPWLARPCHGNCDPTQQEAG
GGEAVVTFEDRARHRQSQRRSRHRRVRTEGKESSSASRSRSASQERSLDEAMPTEGEKDH
ELRGNHGAKEPTIQEERAQDLRRTNSLMVSRGSGLAGGLDEADTPLVLPHPELEVGKHVV
LTEQEPEGSSEQALLGNVQLDMGRVISQSEPDLSCITANTDKATTESTSVTVAIPDVDPL
VDSTVVHISNKTDGEASPLKEAEIREDEEEVEKKKQKKEKRETGKAMVPHSSMFIFSTTN
PIRRACHYIVNLRYFEMCILLVIAASSIALAAEDPVLTNSERNKVLRYFDYVFTGVFTFE
MVIKMIDQGLILQDGSYFRDLWNILDFVVVVGALVAFALANALGTNKGRDIKTIKSLRVL
RVLRPLKTIKRLPKLKAVFDCVVTSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTD
SSKDTEKECIGNYVDHEKNKMEVKGREWKRHEFHYDNIIWALLTLFTVSTGEGWPQVLQH
SVDVTEEDRGPSRSNRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLE
KNERACIDFAISAKPLTRYMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYY
SAPCTYELALKYLNIAFTMVFSLECVLKVIAFGFLNYFRDTWNIFDFITVIGSITEIILT
DSKLVNTSGFNMSFLKLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFI
YAIIGMQVFGNIKLDEESHINRHNNFRSFFGSLMLLFRSATGEAWQEIMLSCLGEKGCEP
DTTAPSGQNENERCGTDLAYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHH
LDEFVRVWAEYDRAACGRIHYTEMYEMLTLMSPPLGLGKRCPSKVAYKRLVLMNMPVAED
MTVHFTSTLMALIRTALDIKIAKGGADRQQLDSELQKETLAIWPHLSQKMLDLLVPMPKA
SDLTVGKIYAAMMIMDYYKQSKVKKQRQQLEEQKNAPMFQRMEPSSLPQEIIANAKALPY
LQQDPVSGLSGRSGYPSMSPLSPQDIFQLACMDPADDGQFQERQSLEPEVSELKSVQPSN
HGIYLPSDTQEHAGSGRASSMPRLTVDPQVVTDPSSMRRSFSTIRDKRSNSSWLEEFSME
RSSENTYKSRRRSYHSSLRLSAHRLNSDSGHKSDTHRSGGRERGRSKERKHLLSPDVSRC
NSEERGTQADWESPERRQSRSPSEGRSQTPNRQGTGSLSESSIPSVSDTSTPRRSRRQLP
PVPPKPRPLLSYSSLIRHAGSISPPADGSEEGSPLTSQALESNNACLTESSNSPHPQQSQ
HASPQRYISEPYLALHEDSHASDCGEEETLTFEAAVATSLGRSNTIGSAPPLRHSWQMPN
GHYRRRRRGGPGPGMMCGAVNNLLSDTEEDDKC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7mixA	0.530	0.912	0.000	1326	0.443	0.773	7mixA.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
2	PDB:7vfsA	0.513	0.922	0.000	1266	0.428	0.783	7vfsA.pdb.gz	Closed-state inactivation and pore-blocker modulation mechanisms of human Ca V 2.2.
3	AFDB:A0A0R4IFN9	0.615	0.613	0.000	2319	0.568	0.566	A0A0R4IFN9.pdb.gz
4	AFDB:O00555	0.645	0.598	0.000	2506	0.590	0.545	O00555.pdb.gz	CAC1A_HUMAN Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Homo sapiens OX=9606 GN=CACNA1A PE=1 SV=3
5	AFDB:P97445	0.642	0.628	0.000	2368	0.595	0.581	P97445.pdb.gz	CAC1A_MOUSE Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Mus musculus OX=10090 GN=Cacna1a PE=1 SV=2
6	AFDB:Q00975	0.639	0.632	0.000	2339	0.580	0.573	Q00975.pdb.gz	CAC1B_HUMAN Voltage-dependent N-type calcium channel subunit alpha-1B OS=Homo sapiens OX=9606 GN=CACNA1B PE=1 SV=1
7	AFDB:Q15878	0.999	0.999	0.000	2313	1.000	1.000	Q15878.pdb.gz	CAC1E_HUMAN Voltage-dependent R-type calcium channel subunit alpha-1E OS=Homo sapiens OX=9606 GN=CACNA1E PE=1 SV=3
8	AFDB:Q61290	0.742	0.755	0.000	2272	0.944	0.961	Q61290.pdb.gz	CAC1E_MOUSE Voltage-dependent R-type calcium channel subunit alpha-1E OS=Mus musculus OX=10090 GN=Cacna1e PE=1 SV=1
9	PDB:7uhfA	0.506	0.939	1.603E-87	1230	0.281	0.528	7uhfA.pdb.gz	Structural basis for pore blockade of human voltage-gated calcium channel Ca v 1.3 by motion sickness drug cinnarizine.
10	PDB:5gjwA	0.522	0.923	1.293E-83	1291	0.289	0.517	5gjwA.pdb.gz	Structure of the voltage-gated calcium channel Cav1.1 at 3.6 angstrom resolution
11	PDB:7jpxA	0.466	0.956	2.634E-81	1116	0.262	0.544	7jpxA.pdb.gz	Structural Basis of the Modulation of the Voltage-Gated Calcium Ion Channel Ca v 1.1 by Dihydropyridine Compounds*.
12	AFDB:Q9Z0Y8	0.474	0.497	4.389E-75	2201	0.236	0.248	Q9Z0Y8.pdb.gz	CAC1I_RAT Voltage-dependent T-type calcium channel subunit alpha-1I OS=Rattus norvegicus OX=10116 GN=Cacna1i PE=1 SV=3
13	AFDB:Q9P0X4	0.484	0.503	1.220E-72	2223	0.241	0.251	Q9P0X4.pdb.gz	CAC1I_HUMAN Voltage-dependent T-type calcium channel subunit alpha-1I OS=Homo sapiens OX=9606 GN=CACNA1I PE=1 SV=1
14	AFDB:Q5SUF7	0.456	0.443	8.609E-69	2381	0.247	0.240	Q5SUF7.pdb.gz	Q5SUF7_MOUSE Voltage-dependent T-type calcium channel subunit alpha OS=Mus musculus OX=10090 GN=Cacna1g PE=1 SV=1
15	AFDB:Q15858	0.505	0.582	1.749E-68	1988	0.196	0.228	Q15858.pdb.gz	SCN9A_HUMAN Sodium channel protein type 9 subunit alpha OS=Homo sapiens OX=9606 GN=SCN9A PE=1 SV=3
16	PDB:7w9lA	0.458	0.727	1.681E-56	1420	0.170	0.277	7w9lA.pdb.gz	High-resolution structures of human Na v 1.7 reveal gating modulation through alpha-pi helical transition of S6 IV.
17	PDB:7wliA	0.425	0.841	4.890E-53	1135	0.157	0.319	7wliA.pdb.gz	Structure, gating, and pharmacology of human Ca V 3.3 channel.
18	PDB:7xveA	0.434	0.762	1.937E-50	1276	0.157	0.285	7xveA.pdb.gz	Unwinding and spiral sliding of S4 and domain rotation of VSD during the electromechanical coupling in Na v 1.7.
19	PDB:3jbrA	0.438	0.792	4.114E-50	1224	0.235	0.444	3jbrA.pdb.gz
20	PDB:7we4A	0.428	0.855	2.316E-49	1122	0.146	0.300	7we4A.pdb.gz	Structural basis for high-voltage activation and subtype-specific inhibition of human Na v 1.8.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZMH8	726	1960	0.159	0.187	A0A8I5ZMH8_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=3 SV=1
2	A0A8I5ZS49	728	1973	0.158	0.185	A0A8I5ZS49_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=3 SV=1
3	A1XIQ4	725	1980	0.159	0.185	A1XIQ4_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=2 SV=1
4	F8W3Z0	1031	2280	0.238	0.242	F8W3Z0_DANRE Calcium channel, voltage-dependent, P/Q type, alpha 1A subunit, b OS=Danio rerio OX=7955 GN=CACNA1Ab PE=2 SV=2
5	G3V9W8	726	1980	0.159	0.185	G3V9W8_RAT Voltage-dependent L-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1f PE=3 SV=1
6	G5EFB0	681	1523	0.172	0.261	G5EFB0_CAEEL EF-hand domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=unc-2 PE=3 SV=2
7	G5EG02	735	1783	0.163	0.211	G5EG02_CAEEL Voltage-dependent L-type calcium channel subunit alpha OS=Caenorhabditis elegans OX=6239 GN=egl-19 PE=1 SV=1
8	O00555	1122	2506	0.248	0.229	CAC1A_HUMAN Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Homo sapiens OX=9606 GN=CACNA1A PE=1 SV=3
9	O35505	741	2169	0.164	0.175	CAC1C_CAVPO Voltage-dependent L-type calcium channel subunit alpha-1C OS=Cavia porcellus OX=10141 GN=CACNA1C PE=1 SV=2
10	O55017	2343	2327	0.580	0.576	CAC1B_MOUSE Voltage-dependent N-type calcium channel subunit alpha-1B OS=Mus musculus OX=10090 GN=Cacna1b PE=1 SV=1
11	O60840	727	1977	0.158	0.185	CAC1F_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1F OS=Homo sapiens OX=9606 GN=CACNA1F PE=1 SV=2
12	O70368	680	791	0.169	0.496	O70368_RAT Class A calcium channel variant riA-I (Fragment) OS=Rattus norvegicus OX=10116 GN=Cacna1a PE=1 SV=1
13	O89089	1240	2333	0.325	0.322	O89089_RAT Voltage-dependent N-type calcium channel subunit alpha OS=Rattus norvegicus OX=10116 GN=Cacna1b PE=1 SV=1
14	P07293	730	1873	0.166	0.204	CAC1S_RABIT Voltage-dependent L-type calcium channel subunit alpha-1S OS=Oryctolagus cuniculus OX=9986 GN=CACNA1S PE=1 SV=1
15	P15381	750	2171	0.165	0.175	CAC1C_RABIT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Oryctolagus cuniculus OX=9986 GN=CACNA1C PE=1 SV=1
16	P22002	734	2169	0.164	0.175	CAC1C_RAT Voltage-dependent L-type calcium channel subunit alpha-1C OS=Rattus norvegicus OX=10116 GN=Cacna1c PE=1 SV=1
17	P27732	716	2203	0.160	0.168	CAC1D_RAT Voltage-dependent L-type calcium channel subunit alpha-1D OS=Rattus norvegicus OX=10116 GN=Cacna1d PE=1 SV=2
18	P27884	1135	2424	0.249	0.238	CAC1A_RABIT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Oryctolagus cuniculus OX=9986 GN=CACNA1A PE=1 SV=1
19	P54282	1109	2212	0.248	0.259	CAC1A_RAT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Rattus norvegicus OX=10116 GN=Cacna1a PE=1 SV=1
20	P91645	743	1851	0.177	0.221	CAC1A_DROME Voltage-dependent calcium channel type A subunit alpha-1 OS=Drosophila melanogaster OX=7227 GN=cac PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08763 Ca_chan_IQ	9.3e-26	101.2	Voltage gated calcium channel IQ domain
2	PF16905 GPHH	2.7e-24	96.1	Voltage-dependent L-type calcium channel, IQ-associated
3	PF00520 Ion_trans	4.6e-242	810.5	Ion transport protein
4	PF08016 PKD_channel	4.6e-09	47.5	Polycystin cation channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356545

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000438949	0.944	Voltage-dependent L-type calcium channel subunit beta-4
2	9606.ENSP00000301050	0.941	Voltage-dependent L-type calcium channel subunit beta-3
3	9606.ENSP00000418081	0.928	Voltage-dependent calcium channel subunit alpha-2/delta-2
4	9606.ENSP00000320025	0.912	Voltage-dependent L-type calcium channel subunit beta-2
5	9606.ENSP00000349320	0.911	Voltage-dependent calcium channel subunit alpha-2/delta-1
6	9606.ENSP00000372169	0.903	Voltage-dependent calcium channel subunit alpha-2/delta-4
7	9606.ENSP00000349467	0.896	Calmodulin-1
8	9606.ENSP00000291295	0.890	Calmodulin 3 (phosphorylase kinase, delta)
9	9606.ENSP00000272298	0.887	Calmodulin 2 (phosphorylase kinase, delta)
10	9606.ENSP00000377840	0.876	Voltage-dependent L-type calcium channel subunit beta-1
11	9606.ENSP00000262138	0.875	Voltage-dependent calcium channel gamma-4 subunit
12	9606.ENSP00000352608	0.859	Ryanodine receptor 1
13	9606.ENSP00000005284	0.856	Voltage-dependent calcium channel gamma-3 subunit
14	9606.ENSP00000419101	0.855	Voltage-dependent calcium channel subunit alpha-2/delta-3
15	9606.ENSP00000353362	0.847	Voltage-dependent P/Q-type calcium channel subunit alpha-1A
16	9606.ENSP00000360423	0.844	Voltage-dependent N-type calcium channel subunit alpha-1B
17	9606.ENSP00000380432	0.836	Insulin
18	9606.ENSP00000360107	0.821	EF-hand domain-containing protein 1
19	9606.ENSP00000334198	0.813	Voltage-dependent T-type calcium channel subunit alpha-1H
20	9606.ENSP00000375647	0.813	Voltage-dependent calcium channel gamma-7 subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005245	1.000	voltage-gated calcium channel activity
GO:0005515	0.988	protein binding
GO:0008331	0.802	high voltage-gated calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0065007	0.936	biological regulation
GO:0050789	0.908	regulation of biological process
GO:0007154	0.881	cell communication
GO:0051179	0.817	localization
GO:0006811	0.802	monoatomic ion transport
GO:0007267	0.796	cell-cell signaling
GO:0007268	0.762	chemical synaptic transmission
GO:0030001	0.751	metal ion transport
GO:0050794	0.660	regulation of cellular process
GO:0032501	0.544	multicellular organismal process
GO:0006816	0.481	calcium ion transport
GO:0050896	0.479	response to stimulus
GO:0065008	0.461	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098797	1.000	plasma membrane protein complex
GO:0034704	0.996	calcium channel complex
GO:0005891	0.991	voltage-gated calcium channel complex
GO:0043226	0.641	organelle
GO:0005622	0.615	intracellular anatomical structure
GO:0045202	0.615	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]