StarFunc result for job id Q15906

User Input

>input (364 residues)
MSLAGGRAPRKTAGNRLSGLLEAEEEDEFYQTTYGGFTEESGDDEYQGDQSDTEDEVDSD
FDIDEGDEPSSDGEAEEPRRKRRVVTKAYKEPLKSLRPRKVNTPAGSSQKAREEKALLPL
ELQDDGSDSRKSMRQSTAEHTRQTFLRVQERQGQSRRRKGPHCERPLTQEELLREAKITE
ELNLRSLETYERLEADKKKQVHKKRKCPGPIITYHSVTVPLVGEPGPKEENVDIEGLDPA
PSVSALTPHAGTGPVNPPARCSRTFITFSDDATFEEWFPQGRPPKVPVREVCPVTHRPAL
YRDPVTDIPYATARAFKIIREAYKKYITAHGLPPTASALGPGPPPPEPLPGSGPRALRQK
IVIK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q62481	0.444	0.440	8.924E-58	368	0.970	0.959	Q62481.pdb.gz	VPS72_MOUSE Vacuolar protein sorting-associated protein 72 homolog OS=Mus musculus OX=10090 GN=Vps72 PE=1 SV=2
2	AFDB:Q9VKM6	0.210	0.214	4.153E-22	351	0.371	0.385	Q9VKM6.pdb.gz	VPS72_DROME Vacuolar protein sorting-associated protein 72 homolog OS=Drosophila melanogaster OX=7227 GN=YL-1 PE=1 SV=1
3	AFDB:U3JAM7	0.093	0.035	3.136E-1	1184	0.154	0.047	U3JAM7.pdb.gz	U3JAM7_DANRE Synaptopodin 2-like b OS=Danio rerio OX=7955 GN=synpo2lb PE=4 SV=1
4	AFDB:Q8IQJ5	0.101	0.060	6.933E-1	648	0.168	0.094	Q8IQJ5.pdb.gz	Q8IQJ5_DROME Uncharacterized protein OS=Drosophila melanogaster OX=7227 GN=Dmel\CG32121 PE=4 SV=2
5	AFDB:F1RCC9	0.074	0.030	7.407E-1	1179	0.170	0.053	F1RCC9.pdb.gz	F1RCC9_DANRE Synaptopodin 2-like a OS=Danio rerio OX=7955 GN=synpo2la PE=4 SV=2
6	AFDB:Q9C8L9	0.065	0.049	7.914E-1	523	0.146	0.101	Q9C8L9.pdb.gz	Q9C8L9_ARATH At1g53640/F22G10.8 OS=Arabidopsis thaliana OX=3702 GN=F22G10.8 PE=1 SV=1
7	AFDB:E7EV75	0.098	0.061	8.455E-1	617	0.080	0.047	E7EV75.pdb.gz	E7EV75_HUMAN Zinc finger MYND-type containing 11 OS=Homo sapiens OX=9606 GN=ZMYND11 PE=1 SV=2
8	AFDB:Q8TDR0	0.115	0.065	8.455E-1	691	0.113	0.059	Q8TDR0.pdb.gz	MIPT3_HUMAN TRAF3-interacting protein 1 OS=Homo sapiens OX=9606 GN=TRAF3IP1 PE=1 SV=1
9	AFDB:Q9I8J4	0.089	0.074	8.455E-1	443	0.124	0.102	Q9I8J4.pdb.gz	Q9I8J4_CHICK Smoothelin-C OS=Gallus gallus OX=9031 GN=Smtn PE=2 SV=1
10	AFDB:Q387V2	0.101	0.053	9.650E-1	704	0.102	0.053	Q387V2.pdb.gz	Q387V2_TRYB2 Zinc finger protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.0730 PE=4 SV=1
11	PDB:6yxyAo	0.049	0.086	1.182	184	0.069	0.136	6yxyAo.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
12	PDB:6fhsC	0.054	0.043	1.878	459	0.044	0.035	6fhsC.pdb.gz	Structural basis for ATP-dependent chromatin remodelling by the INO80 complex.
13	PDB:6gejT	0.052	0.043	1.878	443	0.033	0.027	6gejT.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
14	PDB:6igmC	0.075	0.075	4.436	370	0.047	0.046	6igmC.pdb.gz
15	PDB:6htsE	0.052	0.043	5.409	443	0.036	0.029	6htsE.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
16	PDB:1sksA	0.065	0.040	6.596	681	0.055	0.029	1sksA.pdb.gz	Nucleotide insertion opposite a cis-syn thymine dimer by a replicative DNA polymerase from bacteriophage T7.
17	PDB:5zr1E	0.059	0.048	6.596	460	0.033	0.026	5zr1E.pdb.gz	Structure of the origin recognition complex bound to DNA replication origin.
18	PDB:4v6xCE	0.084	0.104	8.593	262	0.049	0.069	4v6xCE.pdb.gz	Structures of the human and Drosophila 80S ribosome.
19	PDB:5nrlG	0.090	0.088	8.593	372	0.058	0.056	5nrlG.pdb.gz	Structure of a pre-catalytic spliceosome.
20	PDB:5o85D	0.078	0.370	8.593	53	0.014	0.094	5o85D.pdb.gz	The intricate network between the p34 and p44 subunits is central to the activity of the transcription/DNA repair factor TFIIH.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15906	0.0	736	364	1.000	1.000	VPS72_HUMAN Vacuolar protein sorting-associated protein 72 homolog OS=Homo sapiens OX=9606 GN=VPS72 PE=1 SV=1
2	Q62481	0.0	712	368	0.970	0.959	VPS72_MOUSE Vacuolar protein sorting-associated protein 72 homolog OS=Mus musculus OX=10090 GN=Vps72 PE=1 SV=2
3	Q9VKM6	4.59e-60	199	351	0.393	0.407	VPS72_DROME Vacuolar protein sorting-associated protein 72 homolog OS=Drosophila melanogaster OX=7227 GN=YL-1 PE=1 SV=1
4	F4IP06	4.70e-11	65.9	365	0.154	0.153	SWC2_ARATH SWR1 complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=SWC2 PE=1 SV=1
5	Q9P790	3.85e-07	53.5	316	0.195	0.225	VPS72_SCHPO SWR complex protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=swc2 PE=1 SV=1
6	Q9ER60	0.002	42.4	1841	0.074	0.015	SCN4A_MOUSE Sodium channel protein type 4 subunit alpha OS=Mus musculus OX=10090 GN=Scn4a PE=1 SV=1
7	P15390	0.005	41.6	1840	0.071	0.014	SCN4A_RAT Sodium channel protein type 4 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn4a PE=1 SV=1
8	P35499	0.035	38.9	1836	0.063	0.013	SCN4A_HUMAN Sodium channel protein type 4 subunit alpha OS=Homo sapiens OX=9606 GN=SCN4A PE=1 SV=4
9	Q03388	0.049	38.1	795	0.074	0.034	VPS72_YEAST Vacuolar protein sorting-associated protein 72 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VPS72 PE=1 SV=2
10	A0A075B730	0.22	36.2	5063	0.115	0.008	A0A075B730_HUMAN Epiplakin 1 OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=2
11	P58107	0.22	36.2	5088	0.115	0.008	EPIPL_HUMAN Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3
12	O74764	0.24	35.8	606	0.074	0.045	SPB4_SCHPO ATP-dependent rRNA helicase spb4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spb4 PE=3 SV=1
13	Q8RWS0	2.4	31.2	124	0.038	0.113	EEN_ARATH Protein EIN6 ENHANCER OS=Arabidopsis thaliana OX=3702 GN=EEN PE=1 SV=1
14	G5EFL5	4.1	32.0	1424	0.135	0.034	G5EFL5_CAEEL PDZ and LIM domain protein Zasp OS=Caenorhabditis elegans OX=6239 GN=alp-1 PE=1 SV=1
15	P42776	4.9	31.6	382	0.132	0.126	GBF3_ARATH G-box-binding factor 3 OS=Arabidopsis thaliana OX=3702 GN=GBF3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05764 YL1	8.6e-49	178.4	YL1 nuclear protein
2	PF08265 YL1_C	6.9e-09	46.6	YL1 nuclear protein C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000002178

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000051084	0.984	RuvB-like helicase
2	9598.ENSPTRP00000046996	0.975	Pan troglodytes DNA methyltransferase 1 associated protein 1 (DMAP1), mRNA
3	9598.ENSPTRP00000033428	0.957	Uncharacterized protein
4	9598.ENSPTRP00000028020	0.954	Belongs to the histone H2A family.
5	9598.ENSPTRP00000008837	0.948	Uncharacterized protein
6	9598.ENSPTRP00000019330	0.947	RuvB-like helicase
7	9598.ENSPTRP00000023618	0.935	Chromosome 20 open reading frame 20
8	9598.ENSPTRP00000009079	0.918	Uncharacterized protein
9	9598.ENSPTRP00000046150	0.918	Uncharacterized protein
10	9598.ENSPTRP00000053603	0.916	Snf2-related CREBBP activator protein
11	9598.ENSPTRP00000006709	0.896	K(lysine) acetyltransferase 5
12	9598.ENSPTRP00000044965	0.885	E1A binding protein p400
13	9598.ENSPTRP00000032725	0.877	Belongs to the histone H2A family.
14	9598.ENSPTRP00000009603	0.876	Uncharacterized protein
15	9598.ENSPTRP00000014270	0.853	Craniofacial development protein 1
16	9598.ENSPTRP00000041981	0.842	Actin-like 6A
17	9598.ENSPTRP00000051331	0.832	Uncharacterized protein
18	9598.ENSPTRP00000033382	0.805	Uncharacterized protein
19	9598.ENSPTRP00000000965	0.798	Uncharacterized protein
20	9598.ENSPTRP00000004091	0.779	Enhancer of polycomb homolog 1 (Drosophila)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042393	1.000	histone binding
GO:0140713	0.993	histone chaperone activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0060255	0.991	regulation of macromolecule metabolic process
GO:0006325	0.988	chromatin organization
GO:0010468	0.981	regulation of gene expression
GO:0019219	0.978	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.977	positive regulation of cellular process
GO:0016570	0.975	histone modification
GO:0051052	0.973	regulation of DNA metabolic process
GO:0010604	0.972	positive regulation of macromolecule metabolic process
GO:2001020	0.971	regulation of response to DNA damage stimulus
GO:0018205	0.970	peptidyl-lysine modification
GO:0051173	0.966	positive regulation of nitrogen compound metabolic process
GO:0048519	0.962	negative regulation of biological process
GO:0045935	0.959	positive regulation of nucleobase-containing compound metabolic process
GO:0043967	0.951	histone H4 acetylation
GO:0006282	0.939	regulation of DNA repair
GO:0051054	0.929	positive regulation of DNA metabolic process
GO:1903506	0.918	regulation of nucleic acid-templated transcription
GO:0006338	0.917	chromatin remodeling
GO:2000779	0.901	regulation of double-strand break repair
GO:0006355	0.876	regulation of DNA-templated transcription
GO:2001022	0.870	positive regulation of response to DNA damage stimulus
GO:0045739	0.816	positive regulation of DNA repair
GO:0048523	0.810	negative regulation of cellular process
GO:0000018	0.772	regulation of DNA recombination
GO:0051726	0.730	regulation of cell cycle
GO:0010569	0.607	regulation of double-strand break repair via homologous recombination
GO:0045911	0.598	positive regulation of DNA recombination
GO:2000781	0.598	positive regulation of double-strand break repair
GO:0006357	0.521	regulation of transcription by RNA polymerase II
GO:0009892	0.509	negative regulation of metabolic process
GO:0010605	0.495	negative regulation of macromolecule metabolic process
GO:0032502	0.490	developmental process
GO:0032501	0.460	multicellular organismal process
GO:0045934	0.440	negative regulation of nucleobase-containing compound metabolic process
GO:1902679	0.428	negative regulation of RNA biosynthetic process
GO:1903507	0.376	negative regulation of nucleic acid-templated transcription
GO:0000122	0.324	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0000786	0.997	nucleosome
GO:0035267	0.997	NuA4 histone acetyltransferase complex
GO:0016604	0.986	nuclear body
GO:0016607	0.945	nuclear speck
GO:0140513	0.645	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]