StarFunc result for job id Q15910

User Input

>input (746 residues)
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEW
KQRRIQPVHILTSVSSLRGTRECSVTSDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNF
MVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALGQ
YNDDDDDDDGDDPEEREEKQKDLEDHRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEEL
KEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFH
ATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPN
NSSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKM
KPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPA
PAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQ
NFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVS
CKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDK
YMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGE
ELFFDYRYSQADALKYVGIEREMEIP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A090N8E9	0.821	0.815	0.000	751	0.999	0.992	A0A090N8E9.pdb.gz	A0A090N8E9_HUMAN Histone-lysine N-methyltransferase EZH2 OS=Homo sapiens OX=9606 GN=EZH2 PE=4 SV=1
2	AFDB:Q08BS4	0.782	0.769	0.000	760	0.858	0.842	Q08BS4.pdb.gz	EZH2_DANRE Histone-lysine N-methyltransferase EZH2 OS=Danio rerio OX=7955 GN=ezh2 PE=2 SV=1
3	AFDB:S4S3R8	0.749	0.788	0.000	707	0.938	0.990	S4S3R8.pdb.gz	S4S3R8_HUMAN Histone-lysine N-methyltransferase EZH2 OS=Homo sapiens OX=9606 GN=EZH2 PE=4 SV=1
4	AFDB:F1LZH3	0.791	0.790	3.013E-95	747	0.654	0.653	F1LZH3.pdb.gz	F1LZH3_RAT [histone H3]-lysine(27) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Ezh1 PE=4 SV=3
5	PDB:5hynA	0.699	0.889	3.852E-90	581	0.773	0.993	5hynA.pdb.gz	Structural basis of oncogenic histone H3K27M inhibition of human polycomb repressive complex 2.
6	PDB:6wkrC	0.720	0.875	7.163E-86	606	0.810	0.997	6wkrC.pdb.gz	JARID2 and AEBP2 regulate PRC2 in the presence of H2AK119ub1 and other histone modifications.
7	PDB:7td5A	0.625	0.930	7.899E-64	497	0.515	0.773	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
8	PDB:7td5F	0.564	0.933	7.832E-58	447	0.477	0.796	7td5F.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
9	PDB:5wg6A	0.513	0.739	6.983E-55	517	0.519	0.749	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.
10	PDB:7ksoA	0.502	0.935	6.070E-47	395	0.416	0.785	7ksoA.pdb.gz	Structures of monomeric and dimeric PRC2:EZH1 reveal flexible modules involved in chromatin compaction.
11	AFDB:O65312	0.548	0.589	4.728E-36	689	0.251	0.271	O65312.pdb.gz	MEDEA_ARATH Histone-lysine N-methyltransferase MEDEA OS=Arabidopsis thaliana OX=3702 GN=MEA PE=1 SV=1
12	AFDB:O17514	0.576	0.558	6.813E-34	773	0.240	0.232	O17514.pdb.gz	MES2_CAEEL Histone-lysine N-methyltransferase mes-2 OS=Caenorhabditis elegans OX=6239 GN=mes-2 PE=1 SV=2
13	AFDB:K7EIH5	0.280	0.645	8.075E-24	296	0.220	0.554	K7EIH5.pdb.gz	K7EIH5_HUMAN Enhancer of zeste 1 polycomb repressive complex 2 subunit (Fragment) OS=Homo sapiens OX=9606 GN=EZH1 PE=1 SV=1
14	AFDB:Q55FF7	0.213	0.178	5.724E-15	898	0.160	0.133	Q55FF7.pdb.gz	Q55FF7_DICDI SET domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0268132 PE=4 SV=1
15	AFDB:Q945S8	0.164	0.320	1.635E-14	363	0.091	0.187	Q945S8.pdb.gz	ASHH3_ARATH Histone-lysine N-methyltransferase ASHH3 OS=Arabidopsis thaliana OX=3702 GN=ASHH3 PE=2 SV=2
16	AFDB:Q9Y7R4	0.166	0.136	2.039E-14	920	0.182	0.148	Q9Y7R4.pdb.gz	SET1_SCHPO Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set1 PE=1 SV=1
17	PDB:6c24C	0.178	0.753	6.443E-11	148	0.196	0.986	6c24C.pdb.gz	Structures of human PRC2 with its cofactors AEBP2 and JARID2.
18	PDB:1pegA	0.180	0.461	8.638E-10	266	0.068	0.192	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
19	PDB:5h6zA	0.135	0.708	3.064E-6	123	0.032	0.195	5h6zA.pdb.gz
20	PDB:2g46A	0.118	0.613	6.389E-5	119	0.034	0.210	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A090N8E9	0.0	1553	751	0.999	0.992	A0A090N8E9_HUMAN Histone-lysine N-methyltransferase EZH2 OS=Homo sapiens OX=9606 GN=EZH2 PE=4 SV=1
2	A0A0A0MSY9	0.0	976	738	0.650	0.657	A0A0A0MSY9_HUMAN [histone H3]-lysine(27) N-trimethyltransferase OS=Homo sapiens OX=9606 GN=EZH1 PE=1 SV=1
3	A0A8I5ZPT6	0.0	1379	734	0.949	0.965	A0A8I5ZPT6_RAT Histone-lysine N-methyltransferase EZH2 OS=Rattus norvegicus OX=10116 GN=Ezh2 PE=4 SV=1
4	A0A8I6A7B9	0.0	845	681	0.560	0.614	A0A8I6A7B9_RAT [histone H3]-lysine(27) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Ezh1 PE=4 SV=1
5	A0A8I6AHI4	0.0	1395	676	0.891	0.984	A0A8I6AHI4_RAT [histone H3]-lysine(27) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Ezh2 PE=4 SV=1
6	A0A8I6GAA5	0.0	1334	707	0.922	0.973	A0A8I6GAA5_RAT Histone-lysine N-methyltransferase EZH2 OS=Rattus norvegicus OX=10116 GN=Ezh2 PE=4 SV=1
7	A0A8I6GJI6	0.0	1335	704	0.925	0.980	A0A8I6GJI6_RAT Histone-lysine N-methyltransferase EZH2 OS=Rattus norvegicus OX=10116 GN=Ezh2 PE=4 SV=1
8	B5DFE2	0.0	1536	746	0.983	0.983	B5DFE2_RAT Histone-lysine N-methyltransferase EZH2 OS=Rattus norvegicus OX=10116 GN=Ezh2 PE=1 SV=1
9	F1LZH3	0.0	993	750	0.653	0.649	F1LZH3_RAT [histone H3]-lysine(27) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Ezh1 PE=4 SV=3
10	P42124	0.0	629	760	0.440	0.432	EZ_DROME Histone-lysine N-methyltransferase E(z) OS=Drosophila melanogaster OX=7227 GN=E(z) PE=1 SV=2
11	P70351	0.0	982	747	0.653	0.652	EZH1_MOUSE Histone-lysine N-methyltransferase EZH1 OS=Mus musculus OX=10090 GN=Ezh1 PE=1 SV=1
12	Q08BS4	0.0	1310	760	0.862	0.846	EZH2_DANRE Histone-lysine N-methyltransferase EZH2 OS=Danio rerio OX=7955 GN=ezh2 PE=2 SV=1
13	Q15910	0.0	1559	746	1.000	1.000	EZH2_HUMAN Histone-lysine N-methyltransferase EZH2 OS=Homo sapiens OX=9606 GN=EZH2 PE=1 SV=2
14	Q61188	0.0	1539	746	0.984	0.984	EZH2_MOUSE Histone-lysine N-methyltransferase EZH2 OS=Mus musculus OX=10090 GN=Ezh2 PE=1 SV=2
15	Q6AXH7	0.0	1506	742	0.971	0.976	Q6AXH7_MOUSE Histone-lysine N-methyltransferase EZH2 OS=Mus musculus OX=10090 GN=Ezh2 PE=1 SV=1
16	Q92800	0.0	984	747	0.653	0.652	EZH1_HUMAN Histone-lysine N-methyltransferase EZH1 OS=Homo sapiens OX=9606 GN=EZH1 PE=1 SV=2
17	S4S3R8	0.0	1457	707	0.948	1.000	S4S3R8_HUMAN Histone-lysine N-methyltransferase EZH2 OS=Homo sapiens OX=9606 GN=EZH2 PE=4 SV=1
18	K7EIH5	3.61e-101	315	296	0.225	0.568	K7EIH5_HUMAN Enhancer of zeste 1 polycomb repressive complex 2 subunit (Fragment) OS=Homo sapiens OX=9606 GN=EZH1 PE=1 SV=1
19	Q10MI4	1.72e-74	261	895	0.188	0.156	EZ1_ORYSJ Histone-lysine N-methyltransferase EZ1 OS=Oryza sativa subsp. japonica OX=39947 GN=EZ1 PE=1 SV=1
20	Q84UI6	2.03e-74	261	895	0.188	0.156	EZ1_ORYSI Histone-lysine N-methyltransferase EZ1 OS=Oryza sativa subsp. indica OX=39946 GN=EZ1 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11616 EZH2_WD-Binding	1.4e-13	61.9	WD repeat binding protein EZH2
2	PF18118 PRC2_HTH_1	2.6e-27	106.9	Polycomb repressive complex 2 tri-helical domain
3	PF18264 preSET_CXC	1.1e-06	40.3	CXC domain
4	PF00856 SET	1.1e-14	66.7	SET domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005551143.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005579337.1	0.999	Polycomb protein EED isoform X1
2	9541.XP_005583429.1	0.999	Suppressor of zeste 12 protein-like protein
3	9541.XP_005544162.1	0.991	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
4	9541.XP_005570356.1	0.990	Zinc finger protein AEBP2 isoform X1
5	9541.XP_005593110.1	0.990	Core histone-binding subunit that may target chromatin remodeling factors, histone acetyltransferases and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which regulate chromatin metabolism. These include the type B histone acetyltransferase (HAT) complex, which is required for chromatin assembly following DNA replication
6	9541.XP_005587985.1	0.981	Belongs to the class I-like SAM-binding methyltransferase superfamily. C5-methyltransferase family.
7	9541.XP_005553359.1	0.980	PHD finger protein 1 isoform X1
8	9541.XP_005568756.1	0.978	DNA (cytosine-5)-methyltransferase 3B isoform X1
9	9541.XP_005554046.1	0.976	Jumonji/ARID domain-containing protein 2
10	9541.XP_005580979.1	0.971	Polycomb-like protein 3
11	9541.XP_005562259.1	0.967	Transcriptional repressor protein YY1
12	9541.XP_005554043.1	0.962	Protein Jumonji-like isoform X1
13	9541.XP_005557913.1	0.961	Cyclin-dependent kinase 1-like isoform X1
14	9541.XP_005565839.1	0.961	Uncharacterized protein
15	9541.XP_005576448.1	0.959	Belongs to the class I-like SAM-binding methyltransferase superfamily. C5-methyltransferase family
16	9541.XP_005542764.1	0.950	Uncharacterized protein
17	9541.XP_005551686.1	0.949	LOW QUALITY PROTEIN: histone deacetylase 2-like
18	9541.XP_005576572.1	0.949	RB binding protein 4, chromatin remodeling factor
19	9541.XP_005593421.1	0.948	Lysine-specific demethylase 6A
20	9541.XP_005544139.1	0.935	Histone-binding protein RBBP4 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003682	0.999	chromatin binding
GO:0005515	0.998	protein binding
GO:0003676	0.996	nucleic acid binding
GO:0000976	0.994	transcription cis-regulatory region binding
GO:0140096	0.983	catalytic activity, acting on a protein
GO:0016740	0.968	transferase activity
GO:0018024	0.897	histone lysine N-methyltransferase activity
GO:0140938	0.890	histone H3 methyltransferase activity
GO:0046976	0.400	histone H3K27 methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006355	0.985	regulation of DNA-templated transcription
GO:0009987	0.983	cellular process
GO:0032501	0.978	multicellular organismal process
GO:0045892	0.975	negative regulation of DNA-templated transcription
GO:0000122	0.974	negative regulation of transcription by RNA polymerase II
GO:0007399	0.971	nervous system development
GO:0071704	0.957	organic substance metabolic process
GO:0016570	0.945	histone modification
GO:0021761	0.944	limbic system development
GO:0021537	0.934	telencephalon development
GO:0010629	0.910	negative regulation of gene expression
GO:0050896	0.901	response to stimulus
GO:0042221	0.894	response to chemical
GO:0021543	0.879	pallium development
GO:0021766	0.870	hippocampus development
GO:1900015	0.826	regulation of cytokine production involved in inflammatory response
GO:0051241	0.808	negative regulation of multicellular organismal process
GO:0010033	0.787	response to organic substance
GO:0014070	0.783	response to organic cyclic compound
GO:0032355	0.772	response to estradiol
GO:0050773	0.762	regulation of dendrite development
GO:0010976	0.762	positive regulation of neuron projection development
GO:0001818	0.736	negative regulation of cytokine production
GO:0007268	0.731	chemical synaptic transmission
GO:0071840	0.657	cellular component organization or biogenesis
GO:0016043	0.637	cellular component organization
GO:0051094	0.511	positive regulation of developmental process
GO:0006325	0.426	chromatin organization
GO:0044237	0.320	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.992	cytoplasm
GO:0032991	0.962	protein-containing complex
GO:1902494	0.926	catalytic complex
GO:0140513	0.431	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.968	Transferases.
RHEA:51736	0.898	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine
EC:2.1.1.356	0.400	[histone H3]-lysine(27) N-trimethyltransferase.

[back to server]