StarFunc result for job id Q15911

User Input

>input (1400 residues)
MEGCDSPVVSGKDNGCGIPQHQQWTELNSTHLPDKPSSMEQSTGESHGPLDSLRAPFNER
LAESTASAGPPSEPASKEVTCNECSASFASLQTYMEHHCPSARPPPPLREESASDTGEEG
DEESDVENLAGEIVYQPDGSAYIVESLSQLTQGGGACGSGSGSGPLPSLFLNSLPGAGGK
QGDPSCAAPVYPQIINTFHIASSFGKWFEGPDQAFPNTSALAGLSPVLHSFRVFDVRHKS
NKDYLNSDGSAKSSCVSKDVPNNVDLSKFDGFVLYGKRKPILMCFLCKLSFGYVRSFVTH
AVHDHRMTLSEDERKILSNKNISAIIQGIGKDKEPLVSFLEPKNKNFQHPLVSTANLIGP
GHSFYGKFSGIRMEGEEALPAGSAAGPEQPQAGLLTPSTLLNLGGLTSSVLKTPITSVPL
GPLASSPTKSSEGKDSGAAEGEKQEVGDGDCFSEKVEPAEEEAEEEEEEEEAEEEEEEEE
EEEEEEEDEGCKGLFPSELDEELEDRPHEEPGAAAGSSSKKDLALSNQSISNSPLMPNVL
QTLSRGTASTSSNSASSFVVFDGANRRNRLSFNSEGVRANVAEGGRRLDFADESANKDNA
TAPEPNESTEGDDGGFVPHHQHAGSLCELGVGECPSGSGVECPKCDTVLGSSRSLGGHMT
MMHSRNSCKTLKCPKCNWHYKYQQTLEAHMKEKHPEPGGSCVYCKSGQPHPRLARGESYT
CGYKPFRCEVCNYSTTTKGNLSIHMQSDKHLNNMQNLQNGGGEQVFSHTAGAAAAAVAAA
AAAANISSSCGAPSPTKPKTKPTWRCEVCDYETNVARNLRIHMTSEKHMHNMMLLQQNMT
QIQHNRHLGLGSLPSPAEAELYQYYLAQNMNLPNLKMDSAASDAQFMMSGFQLDPAGPMA
AMTPALVGGEIPLDMRLGGGQLVSEELMNLGESFIQTNDPSLKLFQCAVCNKFTTDNLDM
LGLHMNVERSLSEDEWKAVMGDSYQCKLCRYNTQLKANFQLHCKTDKHVQKYQLVAHIKE
GGKANEWRLKCVAIGNPVHLKCNACDYYTNSLEKLRLHTVNSRHEASLKLYKHLQQHESG
VEGESCYYHCVLCNYSTKAKLNLIQHVRSMKHQRSESLRKLQRLQKGLPEEDEDLGQIFT
IRRCPSTDPEEAIEDVEGPSETAADPEELAKDQEGGASSSQAEKELTDSPATSKRISFPG
SSESPLSSKRPKTAEEIKPEQMYQCPYCKYSNADVNRLRVHAMTQHSVQPMLRCPLCQDM
LNNKIHLQLHLTHLHSVAPDCVEKLIMTVTTPEMVMPSSMFLPAAVPDRDGNSNLEEAGK
QPETSEDLGKNILPSASTEQSGDLKPSPADPGSVREDSGFICWKKGCNQVFKTSAALQTH
FNEVHAKRPQLPVSDRHVYK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92766	0.041	0.036	1.165E-5	1687	0.152	0.126	Q92766.pdb.gz	RREB1_HUMAN Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1 PE=1 SV=3
2	AFDB:A0A0K3AUE4	0.041	0.035	1.828E-5	1968	0.140	0.100	A0A0K3AUE4.pdb.gz	SEA2_CAEEL Signal element on autosome protein 2 OS=Caenorhabditis elegans OX=6239 GN=sea-2 PE=1 SV=1
3	AFDB:A2A7B5	0.056	0.047	2.422E-5	1709	0.145	0.119	A2A7B5.pdb.gz	A2A7B5_MOUSE PR domain containing 2, with ZNF domain OS=Mus musculus OX=10090 GN=Prdm2 PE=1 SV=1
4	AFDB:Q5EXX3	0.045	0.051	2.563E-5	1203	0.124	0.145	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
5	AFDB:Q13029	0.051	0.045	6.674E-5	1718	0.159	0.130	Q13029.pdb.gz	PRDM2_HUMAN PR domain zinc finger protein 2 OS=Homo sapiens OX=9606 GN=PRDM2 PE=1 SV=3
6	AFDB:Q8NAP3	0.046	0.049	1.240E-4	1195	0.125	0.146	Q8NAP3.pdb.gz	ZBT38_HUMAN Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=2
7	AFDB:Q9VEW6	0.040	0.053	2.578E-4	924	0.091	0.137	Q9VEW6.pdb.gz	Q9VEW6_DROME IP01015p OS=Drosophila melanogaster OX=7227 GN=pad PE=2 SV=2
8	AFDB:Q9SIV5	0.062	0.054	2.885E-4	1773	0.151	0.119	Q9SIV5.pdb.gz	C3H19_ARATH Zinc finger CCCH domain-containing protein 19 OS=Arabidopsis thaliana OX=3702 GN=NERD PE=1 SV=3
9	AFDB:Q9H582	0.044	0.046	5.361E-4	1327	0.101	0.106	Q9H582.pdb.gz	ZN644_HUMAN Zinc finger protein 644 OS=Homo sapiens OX=9606 GN=ZNF644 PE=1 SV=2
10	AFDB:Q9NZM4	0.039	0.036	1.749E-3	1560	0.161	0.144	Q9NZM4.pdb.gz	BICRA_HUMAN BRD4-interacting chromatin-remodeling complex-associated protein OS=Homo sapiens OX=9606 GN=BICRA PE=1 SV=2
11	PDB:5vvrJ	0.024	0.289	6.900E-1	70	0.005	0.100	5vvrJ.pdb.gz	Structural basis for the initiation of eukaryotic transcription-coupled DNA repair.
12	PDB:5gm6I	0.028	0.332	7.723E-1	102	0.012	0.167	5gm6I.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
13	PDB:5z56v	0.028	0.200	8.170E-1	167	0.007	0.060	5z56v.pdb.gz	Structure of the human activated spliceosome in three conformational states.
14	PDB:3w5kB	0.031	0.208	8.643E-1	110	0.013	0.164	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
15	PDB:5zwmv	0.030	0.217	1.518	174	0.009	0.069	5zwmv.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
16	PDB:5nrlU	0.029	0.190	2.820	196	0.006	0.046	5nrlU.pdb.gz	Structure of a pre-catalytic spliceosome.
17	PDB:6g90U	0.030	0.204	2.983	196	0.005	0.036	6g90U.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
18	PDB:6lss9	0.024	0.368	3.532	86	0.006	0.105	6lss9.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
19	PDB:6qx91C	0.026	0.568	4.182	50	0.006	0.180	6qx91C.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
20	PDB:1zfnA	0.027	0.092	4.681	244	0.006	0.037	1zfnA.pdb.gz	Structural Analysis of Escherichia Coli ThiF.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1M4Q6	0.0	2578	3730	0.946	0.355	F1M4Q6_RAT Zinc finger homeobox 3 OS=Rattus norvegicus OX=10116 GN=Zfhx3 PE=4 SV=3
2	Q15911	0.0	2930	3703	1.000	0.378	ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens OX=9606 GN=ZFHX3 PE=1 SV=2
3	Q61329	0.0	2568	3726	0.931	0.350	ZFHX3_MOUSE Zinc finger homeobox protein 3 OS=Mus musculus OX=10090 GN=Zfhx3 PE=1 SV=1
4	Q9JJN2	0.0	1313	3550	0.557	0.220	ZFHX4_MOUSE Zinc finger homeobox protein 4 OS=Mus musculus OX=10090 GN=Zfhx4 PE=1 SV=1
5	Q2MHN3	3.20e-152	514	2562	0.214	0.117	ZFHX2_MOUSE Zinc finger homeobox protein 2 OS=Mus musculus OX=10090 GN=Zfhx2 PE=1 SV=1
6	Q9C0A1	3.21e-150	508	2572	0.236	0.129	ZFHX2_HUMAN Zinc finger homeobox protein 2 OS=Homo sapiens OX=9606 GN=ZFHX2 PE=1 SV=3
7	P28167	2.13e-102	364	3005	0.158	0.074	ZFH2_DROME Zinc finger protein 2 OS=Drosophila melanogaster OX=7227 GN=zfh2 PE=1 SV=2
8	Q7TS63	1.74e-05	52.0	1237	0.036	0.040	ZFAT_MOUSE Zinc finger protein ZFAT OS=Mus musculus OX=10090 GN=Zfat PE=1 SV=2
9	Q9Y462	2.70e-05	51.2	761	0.064	0.118	ZN711_HUMAN Zinc finger protein 711 OS=Homo sapiens OX=9606 GN=ZNF711 PE=1 SV=2
10	Q9N360	1.43e-04	48.9	662	0.038	0.080	Q9N360_CAEEL C2H2-type domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=znf-782 PE=1 SV=1
11	Q9W0P9	1.83e-04	48.1	442	0.023	0.072	Q9W0P9_DROME Kahuli OS=Drosophila melanogaster OX=7227 GN=Kah PE=2 SV=1
12	O54963	1.93e-04	48.5	1069	0.049	0.065	REST_RAT RE1-silencing transcription factor OS=Rattus norvegicus OX=10116 GN=Rest PE=1 SV=1
13	P08048	2.52e-04	48.1	801	0.023	0.040	ZFY_HUMAN Zinc finger Y-chromosomal protein OS=Homo sapiens OX=9606 GN=ZFY PE=1 SV=3
14	P17010	2.68e-04	48.1	805	0.023	0.040	ZFX_HUMAN Zinc finger X-chromosomal protein OS=Homo sapiens OX=9606 GN=ZFX PE=2 SV=2
15	E9PEP7	3.42e-04	47.8	755	0.023	0.042	E9PEP7_HUMAN Zinc finger protein X-linked OS=Homo sapiens OX=9606 GN=ZFX PE=1 SV=1
16	P17012	3.85e-04	47.4	799	0.023	0.040	ZFX_MOUSE Zinc finger X-chromosomal protein OS=Mus musculus OX=10090 GN=Zfx PE=1 SV=2
17	Q96JP5	6.07e-04	46.6	570	0.021	0.051	ZFP91_HUMAN E3 ubiquitin-protein ligase ZFP91 OS=Homo sapiens OX=9606 GN=ZFP91 PE=1 SV=1
18	E7FAN3	6.27e-04	46.6	764	0.029	0.052	E7FAN3_DANRE Zinc finger protein 408 OS=Danio rerio OX=7955 GN=znf408 PE=4 SV=1
19	Q7K1V0	6.58e-04	46.6	985	0.026	0.038	Q7K1V0_DROME LD39136p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG18011 PE=1 SV=1
20	Q9R1D1	8.93e-04	46.2	737	0.029	0.056	CTCF_RAT Transcriptional repressor CTCF OS=Rattus norvegicus OX=10116 GN=Ctcf PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01803 LIM_bind	2e+02	12.9	LIM-domain binding protein
2	PF00291 PALP	66	14.4	Pyridoxal-phosphate dependent enzyme
3	PF00096 zf-C2H2	0.00037	31.9	Zinc finger, C2H2 type
4	PF12756 zf-C2H2_2	21	16.9	C2H2 type zinc-finger (2 copies)
5	PF13894 zf-C2H2_4	0.0037	29.0	C2H2-type zinc finger
6	PF05605 zf-Di19	0.012	27.2	Drought induced 19 protein (Di19), zinc-binding
7	PF13909 zf-H2C2_5	0.042	24.9	C2H2-type zinc-finger domain
8	PF12874 zf-met	0.55	21.9	Zinc-finger of C2H2 type
9	PF18414 zf_C2H2_10	2.3e+02	12.7	C2H2 type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000268489

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382800	0.962	Runt-related transcription factor 3
2	9606.ENSP00000376765	0.950	E3 SUMO-protein ligase PIAS3
3	9606.ENSP00000384849	0.908	Cyclin-dependent kinase inhibitor 1
4	9606.ENSP00000221930	0.900	Transforming growth factor beta-1
5	9606.ENSP00000304169	0.790	Pituitary homeobox 2
6	9606.ENSP00000404705	0.750	Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2
7	9606.ENSP00000355260	0.725	Protein phosphatase 1 regulatory subunit 14C
8	9606.ENSP00000405330	0.706	Estrogen receptor
9	9606.ENSP00000481848	0.681	Small conductance calcium-activated potassium channel protein 3
10	9606.ENSP00000333539	0.644	Mirror-image polydactyly 1
11	9606.ENSP00000342931	0.643	Pituitary-specific positive transcription factor 1
12	9606.ENSP00000239461	0.640	Paired mesoderm homeobox protein 1
13	9606.ENSP00000364464	0.627	Aminopeptidase O
14	9606.ENSP00000263925	0.618	E3 ubiquitin-protein ligase LNX
15	9606.ENSP00000378289	0.608	Synaptopodin 2-like protein
16	9606.ENSP00000358795	0.605	E3 ubiquitin-protein ligase NEURL1
17	9606.ENSP00000335255	0.591	Angiopoietin-related protein 5
18	9606.ENSP00000472808	0.591	Zinc finger protein 473
19	9606.ENSP00000292566	0.590	Alpha-ketoglutarate-dependent dioxygenase alkB homolog 4
20	9606.ENSP00000340465	0.586	Sodium-dependent phosphate transporter 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000978	0.998	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.977	regulation of biological process
GO:0050794	0.913	regulation of cellular process
GO:0019222	0.374	regulation of metabolic process
GO:0051171	0.356	regulation of nitrogen compound metabolic process
GO:0080090	0.354	regulation of primary metabolic process
GO:0048518	0.346	positive regulation of biological process
GO:0060255	0.341	regulation of macromolecule metabolic process
GO:0031323	0.336	regulation of cellular metabolic process
GO:0006357	0.331	regulation of transcription by RNA polymerase II
GO:0048522	0.324	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.996	nucleus
GO:0005737	0.975	cytoplasm
GO:0043233	0.585	organelle lumen
GO:0070013	0.584	intracellular organelle lumen
GO:0031981	0.568	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]