StarFunc result for job id Q15928

User Input

>input (474 residues)
MELLTFRDVAIEFSPEEWKCLDPDQQNLYRDVMLENYRNLVSLGVAISNPDLVTCLEQRK
EPYNVKIHKIVARPPAMCSHFTQDHWPVQGIEDSFHKLILRRYEKCGHDNLQLRKGCKSL
NECKLQKGGYNEFNECLSTTQSKILQCKASVKVVSKFSNSNKRKTRHTGEKHFKECGKSF
QKFSHLTQHKVIHAGEKPYTCEECGKAFKWSLIFNEHKRIHTGEKPFTCEECGSIFTTSS
HFAKHKIIHTGEKPYKCEECGKAFNRFTTLTKHKRIHAGEKPITCEECRKIFTSSSNFAK
HKRIHTGEKPYKCEECGKAFNRSTTLTKHKRIHTGEKPYTCEECGKAFRQSSKLNEHKKV
HTGERPYKCDECGKAFGRSRVLNEHKKIHTGEKPYKCEECGKAFRRSTDRSQHKKIHSAD
KPYKCKECDKAFKQFSLLSQHKKIHTVDKPYKCKDCDKAFKRFSHLNKHKKIHT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15928	1.000	1.000	6.862E-82	474	1.000	1.000	Q15928.pdb.gz	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
2	AFDB:A6NNF4	0.401	0.271	4.154E-54	738	0.629	0.404	A6NNF4.pdb.gz	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
3	AFDB:Q03923	0.416	0.339	4.154E-54	595	0.635	0.506	Q03923.pdb.gz	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
4	AFDB:P35789	0.292	0.229	7.298E-54	620	0.656	0.502	P35789.pdb.gz	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
5	AFDB:Q96JC4	0.427	0.389	8.643E-54	524	0.656	0.594	Q96JC4.pdb.gz	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
6	AFDB:Q14593	0.422	0.357	1.700E-53	569	0.648	0.540	Q14593.pdb.gz	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
7	AFDB:Q05481	0.354	0.171	3.742E-53	1191	0.641	0.255	Q05481.pdb.gz	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
8	AFDB:Q8IYN0	0.403	0.360	4.431E-53	542	0.629	0.550	Q8IYN0.pdb.gz	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
9	AFDB:Q8IYB9	0.361	0.269	8.237E-53	648	0.665	0.486	Q8IYB9.pdb.gz	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
10	AFDB:Q8TD23	0.408	0.347	2.165E-51	568	0.658	0.549	Q8TD23.pdb.gz	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
11	PDB:3w5kB	0.101	0.272	2.052E-4	110	0.080	0.345	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4wa6D	0.072	0.077	2.004	415	0.042	0.048	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
13	PDB:7c4jB	0.080	0.091	2.120	395	0.093	0.111	7c4jB.pdb.gz
14	PDB:6bk8O	0.064	0.105	2.810	229	0.046	0.096	6bk8O.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
15	PDB:6gejS	0.052	0.107	3.146	208	0.051	0.115	6gejS.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
16	PDB:8ap8d	0.081	0.114	3.725	270	0.061	0.107	8ap8d.pdb.gz
17	PDB:7uhyC	0.058	0.050	3.941	578	0.034	0.028	7uhyC.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
18	PDB:5c8dE	0.046	0.065	4.412	280	0.015	0.025	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
19	PDB:6id0L	0.059	0.059	4.667	475	0.097	0.097	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
20	PDB:7mqaNA	0.072	0.100	4.667	295	0.108	0.173	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NNF4	0.0	619	616	0.635	0.489	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
2	O75437	0.0	584	659	0.622	0.448	ZN254_HUMAN Zinc finger protein 254 OS=Homo sapiens OX=9606 GN=ZNF254 PE=2 SV=3
3	P17038	0.0	582	809	0.622	0.365	ZNF43_HUMAN Zinc finger protein 43 OS=Homo sapiens OX=9606 GN=ZNF43 PE=2 SV=4
4	P35789	0.0	614	620	0.643	0.492	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
5	Q03923	0.0	616	595	0.643	0.513	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
6	Q03936	0.0	619	586	0.671	0.543	ZNF92_HUMAN Zinc finger protein 92 OS=Homo sapiens OX=9606 GN=ZNF92 PE=1 SV=2
7	Q05481	0.0	592	1191	0.633	0.252	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
8	Q14593	0.0	635	569	0.658	0.548	ZN273_HUMAN Zinc finger protein 273 OS=Homo sapiens OX=9606 GN=ZNF273 PE=1 SV=3
9	Q15928	0.0	970	474	1.000	1.000	ZN141_HUMAN Zinc finger protein 141 OS=Homo sapiens OX=9606 GN=ZNF141 PE=1 SV=1
10	Q2NKJ9	0.0	612	569	0.656	0.547	Q2NKJ9_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=1
11	Q5JVG8	0.0	518	444	0.549	0.586	ZN506_HUMAN Zinc finger protein 506 OS=Homo sapiens OX=9606 GN=ZNF506 PE=2 SV=2
12	Q8IW36	0.0	531	515	0.584	0.538	ZN695_HUMAN Zinc finger protein 695 OS=Homo sapiens OX=9606 GN=ZNF695 PE=1 SV=4
13	Q8IYB9	0.0	656	648	0.692	0.506	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
14	Q8IYN0	0.0	606	542	0.637	0.557	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
15	Q8IYX0	0.0	521	411	0.555	0.640	ZN679_HUMAN Zinc finger protein 679 OS=Homo sapiens OX=9606 GN=ZNF679 PE=1 SV=2
16	Q8TD23	0.0	613	568	0.650	0.542	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
17	Q96H40	0.0	556	463	0.578	0.592	ZN486_HUMAN Zinc finger protein 486 OS=Homo sapiens OX=9606 GN=ZNF486 PE=2 SV=4
18	Q96JC4	0.0	625	524	0.658	0.595	ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens OX=9606 GN=ZNF479 PE=1 SV=1
19	Q9H8G1	0.0	608	570	0.656	0.546	ZN430_HUMAN Zinc finger protein 430 OS=Homo sapiens OX=9606 GN=ZNF430 PE=1 SV=3
20	Q49A12	1.45e-176	508	536	0.536	0.474	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01352 KRAB	3.2e-22	89.2	KRAB box
2	PF10484 MRP-S23	69	15.1	Mitochondrial ribosomal protein S23
3	PF01286 XPA_N	2.6e-12	57.8	XPA protein N-terminal
4	PF01428 zf-AN1	6.5	18.3	AN1-like Zinc finger
5	PF00096 zf-C2H2	3e-45	161.3	Zinc finger, C2H2 type
6	PF16622 zf-C2H2_11	7	17.8	zinc-finger C2H2-type
7	PF13894 zf-C2H2_4	1.8e-23	92.2	C2H2-type zinc finger
8	PF13912 zf-C2H2_6	2.1e-14	64.3	C2H2-type zinc finger
9	PF15909 zf-C2H2_8	0.51	22.0	C2H2-type zinc ribbon
10	PF12171 zf-C2H2_jaz	2.7e-08	45.1	Zinc-finger double-stranded RNA-binding
11	PF13465 zf-H2C2_2	7.7e-74	252.3	Zinc-finger double domain
12	PF12874 zf-met	74	15.1	Zinc-finger of C2H2 type
13	PF02591 zf-RING_7	6.1e-08	44.0	C4-type zinc ribbon domain
14	PF13451 zf-trcl	0.3	22.3	Probable zinc-ribbon domain
15	PF18439 zf_UBZ	7.6e-09	46.4	Ubiquitin-Binding Zinc Finger
16	PF17032 zinc_ribbon_15	2	20.5	zinc-ribbon family
17	PF09723 Zn-ribbon_8	1.3e-07	42.9	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000240499

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000480715	0.734	IQ domain-containing protein E
2	9606.ENSP00000429367	0.642	Protein FAM92A
3	9606.ENSP00000331385	0.637	Uncharacterized protein KIAA0825
4	9606.ENSP00000333539	0.580	Mirror-image polydactyly 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.969	regulation of cellular process
GO:0009892	0.948	negative regulation of metabolic process
GO:0031323	0.920	regulation of cellular metabolic process
GO:0009889	0.919	regulation of biosynthetic process
GO:0010468	0.919	regulation of gene expression
GO:0009987	0.880	cellular process
GO:0009890	0.807	negative regulation of biosynthetic process
GO:0031324	0.806	negative regulation of cellular metabolic process
GO:0010605	0.801	negative regulation of macromolecule metabolic process
GO:0051172	0.773	negative regulation of nitrogen compound metabolic process
GO:0010556	0.749	regulation of macromolecule biosynthetic process
GO:0031326	0.748	regulation of cellular biosynthetic process
GO:0051252	0.743	regulation of RNA metabolic process
GO:0031327	0.697	negative regulation of cellular biosynthetic process
GO:0010558	0.690	negative regulation of macromolecule biosynthetic process
GO:0051253	0.665	negative regulation of RNA metabolic process
GO:0006355	0.643	regulation of DNA-templated transcription
GO:0008152	0.576	metabolic process
GO:0044237	0.572	cellular metabolic process
GO:0032502	0.545	developmental process
GO:0048856	0.508	anatomical structure development
GO:0071704	0.493	organic substance metabolic process
GO:1902679	0.453	negative regulation of RNA biosynthetic process
GO:0045892	0.436	negative regulation of DNA-templated transcription
GO:0032501	0.402	multicellular organismal process
GO:0007275	0.387	multicellular organism development
GO:0044238	0.338	primary metabolic process
GO:0009653	0.309	anatomical structure morphogenesis
GO:0006807	0.307	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031974	0.942	membrane-enclosed lumen
GO:0031981	0.922	nuclear lumen
GO:0005654	0.883	nucleoplasm
GO:0005737	0.517	cytoplasm
GO:0043232	0.445	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]