StarFunc result for job id Q15937

User Input

>input (498 residues)
MLEEGVLPSPGPALPQEENTGEEGMAAGLLTAGPRGSTFFSSVTVAFAQERWRCLVSTPR
DRFKEGIPGKSRSLVLLGLPVSQPGMNSQLEQREGAWMLEGEDLRSPSPGWKIISGSPPE
QALSEASFQDPCVEMPPGDSDHGTSDLEKSFNLRPVLSPQQRVPVEARPRKCETHTESFK
NSEILKPHRAKPYACNECGKAFSYCSSLSQHQKSHTGEKPYECSECGKAFSQSSSLIQHQ
RIHTGEKPYKCSECGRAFSQNANLTKHQRTHTGEKPYRCSECEKAFSDCSALVQHQRIHT
GEKPYECSDCGKAFRHSANLTNHQRTHTGEKPYKCSECGKAFSYCAAFIQHQRIHTGEKP
YRCAACGKAFSQSANLTNHQRTHTGEKPYKCSECGKAFSQSTNLIIHQKTHTGEKPYKCN
ECGKFFSESSALIRHHIIHTGEKPYECNECGKAFNQSSSLSQHQRIHTGVKPYECSECGK
AFRCSSAFVRHQRLHAGE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q15937	1.000	1.000	2.313E-84	498	1.000	1.000	Q15937.pdb.gz	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
2	AFDB:Q9UJW8	0.452	0.344	2.999E-45	692	0.466	0.335	Q9UJW8.pdb.gz	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
3	AFDB:Q9P0L1	0.450	0.321	9.658E-45	754	0.466	0.308	Q9P0L1.pdb.gz	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
4	AFDB:P17027	0.577	0.455	3.227E-43	643	0.444	0.344	P17027.pdb.gz	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
5	AFDB:P17020	0.553	0.415	3.814E-43	682	0.496	0.362	P17020.pdb.gz	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
6	AFDB:Q8TF45	0.567	0.425	5.038E-43	676	0.412	0.303	Q8TF45.pdb.gz	ZN418_HUMAN Zinc finger protein 418 OS=Homo sapiens OX=9606 GN=ZNF418 PE=1 SV=2
7	AFDB:P51814	0.479	0.313	1.716E-42	821	0.492	0.298	P51814.pdb.gz	ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens OX=9606 GN=ZNF41 PE=1 SV=2
8	AFDB:Q9P2J8	0.496	0.308	2.679E-42	865	0.450	0.259	Q9P2J8.pdb.gz	ZN624_HUMAN Zinc finger protein 624 OS=Homo sapiens OX=9606 GN=ZNF624 PE=1 SV=3
9	AFDB:P17097	0.349	0.259	6.531E-42	686	0.452	0.328	P17097.pdb.gz	ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens OX=9606 GN=ZNF7 PE=1 SV=1
10	AFDB:A0A0A0MS50	0.455	0.389	1.020E-41	604	0.460	0.379	A0A0A0MS50.pdb.gz	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
11	PDB:3w5kB	0.096	0.274	5.235E-4	110	0.086	0.391	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:5c8dE	0.076	0.100	8.162E-1	280	0.040	0.071	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
13	PDB:5xncB	0.058	0.074	9.646E-1	354	0.028	0.040	5xncB.pdb.gz	Active site geometry of a novel aminopropyltransferase for biosynthesis of hyperthermophile-specific branched-chain polyamine.
14	PDB:7ena4	0.074	0.078	1.078	457	0.064	0.070	7ena4.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
15	PDB:1y11A	0.064	0.081	1.506	364	0.032	0.044	1y11A.pdb.gz
16	PDB:7ad8D	0.050	0.077	1.684	280	0.040	0.071	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
17	PDB:7dvqM	0.045	0.087	1.990	191	0.058	0.152	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
18	PDB:6ff4t	0.049	0.099	2.104	172	0.058	0.169	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
19	PDB:7cunA	0.072	0.055	2.352	730	0.052	0.036	7cunA.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
20	PDB:7qcdD	0.066	0.086	2.352	326	0.048	0.074	7qcdD.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q15937	0.0	1026	498	1.000	1.000	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
2	Q6ZN57	2.68e-158	459	461	0.456	0.492	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
3	Q8NA42	3.54e-156	454	475	0.474	0.497	ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens OX=9606 GN=ZNF383 PE=1 SV=1
4	Q9P0L1	3.09e-154	459	754	0.486	0.321	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
5	Q8WV37	1.28e-153	450	535	0.476	0.443	ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=2
6	A0A0C4DG42	2.08e-153	449	539	0.506	0.468	A0A0C4DG42_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=1
7	Q8IZ26	2.84e-153	450	560	0.506	0.450	ZNF34_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=3
8	P52742	5.38e-153	452	658	0.508	0.384	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
9	Q6ECI4	1.46e-152	454	717	0.490	0.340	ZN470_HUMAN Zinc finger protein 470 OS=Homo sapiens OX=9606 GN=ZNF470 PE=2 SV=3
10	P17020	8.80e-151	448	682	0.442	0.323	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
11	P15622	5.24e-150	442	560	0.504	0.448	ZN250_HUMAN Zinc finger protein 250 OS=Homo sapiens OX=9606 GN=ZNF250 PE=1 SV=3
12	Q8TAQ5	2.22e-149	444	688	0.486	0.352	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
13	Q96HQ0	3.29e-149	438	510	0.462	0.451	ZN419_HUMAN Zinc finger protein 419 OS=Homo sapiens OX=9606 GN=ZNF419 PE=1 SV=2
14	Q9C0F3	4.16e-149	436	470	0.466	0.494	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
15	Q03923	1.07e-148	439	595	0.456	0.382	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
16	O60765	1.54e-148	439	605	0.490	0.403	Z354A_HUMAN Zinc finger protein 354A OS=Homo sapiens OX=9606 GN=ZNF354A PE=1 SV=2
17	V9HWI2	1.54e-148	439	605	0.490	0.403	V9HWI2_HUMAN Epididymis luminal protein 104 OS=Homo sapiens OX=9606 GN=HEL104 PE=2 SV=1
18	Q86Y25	2.08e-148	437	554	0.488	0.439	Z354C_HUMAN Zinc finger protein 354C OS=Homo sapiens OX=9606 GN=ZNF354C PE=1 SV=1
19	Q08ER8	2.85e-148	439	600	0.480	0.398	ZN543_HUMAN Zinc finger protein 543 OS=Homo sapiens OX=9606 GN=ZNF543 PE=1 SV=3
20	Q3V362	7.37e-148	438	622	0.484	0.387	Q3V362_MOUSE Zinc finger protein 251 (Fragment) OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07975 C1_4	0.26	22.9	TFIIH C1-like domain
2	PF20026 DUF6434	3.5e+02	12.6	Domain of unknown function (DUF6434)
3	PF18023 FKBP_N_2	9.6	17.7	BDBT FKBP like N-terminal
4	PF19335 HMBD	2	19.7	Heavy metal binding domain
5	PF01844 HNH	2.1e+02	13.5	HNH endonuclease
6	PF01096 TFIIS_C	1.8e+02	13.4	Transcription factor S-II (TFIIS)
7	PF01286 XPA_N	0.0014	29.9	XPA protein N-terminal
8	PF14149 YhfH	8.4	17.8	YhfH-like protein
9	PF00096 zf-C2H2	5.3e-65	223.6	Zinc finger, C2H2 type
10	PF16622 zf-C2H2_11	3.1e-05	34.9	zinc-finger C2H2-type
11	PF13894 zf-C2H2_4	2.2e-36	132.3	C2H2-type zinc finger
12	PF13912 zf-C2H2_6	1.8e-18	77.3	C2H2-type zinc finger
13	PF12171 zf-C2H2_jaz	4.2e-08	44.5	Zinc-finger double-stranded RNA-binding
14	PF13465 zf-H2C2_2	2.9e-99	332.8	Zinc-finger double domain
15	PF01753 zf-MYND	1.4e+02	14.0	MYND finger
16	PF18439 zf_UBZ	3.1e-07	41.2	Ubiquitin-Binding Zinc Finger
17	PF17032 zinc_ribbon_15	1.6e-05	36.9	zinc-ribbon family
18	PF09723 Zn-ribbon_8	6.8e-07	40.6	Zinc ribbon domain
19	PF13408 Zn_ribbon_recom	35	16.3	Recombinase zinc beta ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362446

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360882	0.734	Collagen alpha-1(V) chain
2	9606.ENSP00000227474	0.708	tRNA pseudouridine(38/39) synthase
3	9606.ENSP00000485326	0.645	Olfactory receptor 2AG1
4	9606.ENSP00000373574	0.622	Serine/threonine-protein kinase receptor R3
5	9606.ENSP00000362299	0.580	Endoglin
6	9606.ENSP00000365837	0.576	tRNA pseudouridine synthase A
7	9606.ENSP00000233156	0.558	Tissue factor pathway inhibitor
8	9606.ENSP00000363708	0.555	Bone morphogenetic protein receptor type-2
9	9606.ENSP00000168216	0.515	3-hydroxyacyl-CoA dehydrogenase type-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.492	heterocyclic compound binding
GO:0097159	0.492	organic cyclic compound binding
GO:0003676	0.467	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.987	biological regulation
GO:0050794	0.953	regulation of cellular process
GO:0019222	0.751	regulation of metabolic process
GO:0009987	0.708	cellular process
GO:0050896	0.638	response to stimulus
GO:0060255	0.628	regulation of macromolecule metabolic process
GO:0031323	0.605	regulation of cellular metabolic process
GO:0048519	0.579	negative regulation of biological process
GO:0009889	0.570	regulation of biosynthetic process
GO:0048523	0.563	negative regulation of cellular process
GO:0051171	0.556	regulation of nitrogen compound metabolic process
GO:0080090	0.552	regulation of primary metabolic process
GO:0006355	0.531	regulation of DNA-templated transcription
GO:0051716	0.497	cellular response to stimulus
GO:0010605	0.378	negative regulation of macromolecule metabolic process
GO:0045934	0.348	negative regulation of nucleobase-containing compound metabolic process
GO:0010558	0.325	negative regulation of macromolecule biosynthetic process
GO:0031327	0.325	negative regulation of cellular biosynthetic process
GO:0032501	0.315	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.998	nuclear lumen
GO:0005654	0.993	nucleoplasm
GO:0005737	0.985	cytoplasm
GO:0005829	0.745	cytosol
GO:0071944	0.487	cell periphery
GO:0043232	0.475	intracellular non-membrane-bounded organelle
GO:0016020	0.303	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]