StarFunc result for job id Q16099

User Input

>input (956 residues)
MPRVSAPLVLLPAWLVMVACSPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLG
KAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFK
VAPEEFVKFQFQRFTTLNLHPSNTDISVAVAGILNFFNCTTACLICAKAECLLNLEKLLR
QFLISKDTLSVRMLDDTRDPTPLLKEIRDDKTATIIIHANASMSHTILLKAAELGMVSAY
YTYIFTNLEFSLQRMDSLVDDRVNILGFSIFNQSHAFFQEFAQSLNQSWQENCDHVPFTG
PALSSALLFDAVYAVVTAVQELNRSQEIGVKPLSCGSAQIWQHGTSLMNYLRMVELEGLT
GHIEFNSKGQRSNYALKILQFTRNGFRQIGQWHVAEGLSMDSHLYASNISDTLFNTTLVV
TTILENPYLMLKGNHQEMEGNDRYEGFCVDMLKELAEILRFNYKIRLVGDGVYGVPEANG
TWTGMVGELIARKADLAVAGLTITAEREKVIDFSKPFMTLGISILYRVHMGRKPGYFSFL
DPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYSPHPCAQGRCNLLVNQYSLGNSLWFP
VGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMDVPIESVDDLA
DQTAIEYGTIHGGSSMTFFQNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSNYAF
LLESTMNEYYRQRNCNLTQIGGLLDTKGYGIGMPVGSVFRDEFDLAILQLQENNRLEILK
RKWWEGGKCPKEEDHRAKGLGMENIGGIFVVLICGLIVAIFMAMLEFLWTLRHSEATEVS
VCQEMVTELRSIILCQDSIHPRRRRAAVPPPRPPIPEERRPRGTATLSNGKLCGAGEPDQ
LAQRLAQEAALVARGCTHIRVCPECRRFQGLRARPSPARSEESLEWEKTTNSSEPE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q01812	0.934	0.934	0.000	956	0.978	0.978	Q01812.pdb.gz	GRIK4_RAT Glutamate receptor ionotropic, kainate 4 OS=Rattus norvegicus OX=10116 GN=Grik4 PE=1 SV=1
2	AFDB:Q16478	0.838	0.818	0.000	980	0.677	0.660	Q16478.pdb.gz	GRIK5_HUMAN Glutamate receptor ionotropic, kainate 5 OS=Homo sapiens OX=9606 GN=GRIK5 PE=2 SV=2
3	AFDB:E7ENK3	0.778	0.783	7.972E-93	949	0.391	0.394	E7ENK3.pdb.gz	E7ENK3_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
4	PDB:7ks0A	0.629	0.788	2.154E-91	741	0.577	0.745	7ks0A.pdb.gz
5	AFDB:P39087	0.644	0.676	2.755E-89	908	0.405	0.426	P39087.pdb.gz	GRIK2_MOUSE Glutamate receptor ionotropic, kainate 2 OS=Mus musculus OX=10090 GN=Grik2 PE=1 SV=4
6	AFDB:B1AS29	0.670	0.696	4.743E-89	919	0.385	0.400	B1AS29.pdb.gz	GRIK3_MOUSE Glutamate receptor ionotropic, kainate 3 OS=Mus musculus OX=10090 GN=Grik3 PE=1 SV=1
7	AFDB:Q9VDH5	0.579	0.634	2.244E-87	853	0.350	0.393	Q9VDH5.pdb.gz	Q9VDH5_DROME Kainate-type ionotropic glutamate receptor subunit 1D OS=Drosophila melanogaster OX=7227 GN=KaiR1D PE=1 SV=1
8	AFDB:B3DGZ2	0.714	0.756	7.754E-84	898	0.325	0.346	B3DGZ2.pdb.gz
9	AFDB:A0A0R4ING5	0.679	0.714	3.361E-83	903	0.323	0.342	A0A0R4ING5.pdb.gz
10	AFDB:P19491	0.691	0.742	1.911E-82	883	0.327	0.354	P19491.pdb.gz	GRIA2_RAT Glutamate receptor 2 OS=Rattus norvegicus OX=10116 GN=Gria2 PE=1 SV=2
11	AFDB:P19490	0.672	0.704	7.039E-82	907	0.329	0.347	P19490.pdb.gz	GRIA1_RAT Glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Gria1 PE=1 SV=2
12	PDB:7ocaA	0.524	0.624	6.040E-73	775	0.314	0.387	7ocaA.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.
13	PDB:7rz4A	0.624	0.603	7.758E-72	993	0.315	0.303	7rz4A.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
14	PDB:7rzaA	0.572	0.559	4.659E-71	981	0.309	0.301	7rzaA.pdb.gz	Structure and desensitization of AMPA receptor complexes with type II TARP gamma 5 and GSG1L.
15	PDB:4uqqA	0.593	0.792	4.816E-70	693	0.331	0.456	4uqqA.pdb.gz	Structural Mechanism of Glutamate Receptor Activation and Desensitization
16	PDB:7vm2B	0.369	0.475	8.290E-70	736	0.338	0.439	7vm2B.pdb.gz
17	PDB:5kufA	0.617	0.766	7.281E-69	750	0.360	0.459	5kufA.pdb.gz	Structural basis of kainate subtype glutamate receptor desensitization.
18	PDB:5weoA	0.620	0.602	8.116E-69	988	0.315	0.305	5weoA.pdb.gz	Channel opening and gating mechanism in AMPA-subtype glutamate receptors.
19	PDB:5kbtA	0.612	0.603	1.065E-68	973	0.306	0.301	5kbtA.pdb.gz	Elucidation of AMPA receptor-stargazin complexes by cryo-electron microscopy.
20	PDB:5idfB	0.360	0.460	1.525E-67	734	0.287	0.373	5idfB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	B1AS29	701	919	0.389	0.405	GRIK3_MOUSE Glutamate receptor ionotropic, kainate 3 OS=Mus musculus OX=10090 GN=Grik3 PE=1 SV=1
2	E7ENK3	684	949	0.383	0.386	E7ENK3_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
3	E9PD61	685	920	0.383	0.398	E9PD61_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
4	F7AGW3	684	949	0.383	0.386	F7AGW3_MACMU Glutamate receptor OS=Macaca mulatta OX=9544 GN=GRIK1 PE=3 SV=2
5	H7BYG7	683	871	0.383	0.420	H7BYG7_HUMAN Glutamate receptor OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
6	P22756	673	949	0.382	0.385	GRIK1_RAT Glutamate receptor ionotropic, kainate 1 OS=Rattus norvegicus OX=10116 GN=Grik1 PE=1 SV=3
7	P39086	687	918	0.384	0.400	GRIK1_HUMAN Glutamate receptor ionotropic, kainate 1 OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1
8	P39087	727	908	0.410	0.432	GRIK2_MOUSE Glutamate receptor ionotropic, kainate 2 OS=Mus musculus OX=10090 GN=Grik2 PE=1 SV=4
9	P42260	728	908	0.411	0.433	GRIK2_RAT Glutamate receptor ionotropic, kainate 2 OS=Rattus norvegicus OX=10116 GN=Grik2 PE=1 SV=2
10	P42264	702	919	0.390	0.406	GRIK3_RAT Glutamate receptor ionotropic, kainate 3 OS=Rattus norvegicus OX=10116 GN=Grik3 PE=1 SV=1
11	Q01812	1953	956	0.978	0.978	GRIK4_RAT Glutamate receptor ionotropic, kainate 4 OS=Rattus norvegicus OX=10116 GN=Grik4 PE=1 SV=1
12	Q13002	730	908	0.413	0.435	GRIK2_HUMAN Glutamate receptor ionotropic, kainate 2 OS=Homo sapiens OX=9606 GN=GRIK2 PE=1 SV=1
13	Q13003	706	919	0.391	0.407	GRIK3_HUMAN Glutamate receptor ionotropic, kainate 3 OS=Homo sapiens OX=9606 GN=GRIK3 PE=2 SV=3
14	Q16099	1990	956	1.000	1.000	GRIK4_HUMAN Glutamate receptor ionotropic, kainate 4 OS=Homo sapiens OX=9606 GN=GRIK4 PE=2 SV=2
15	Q16478	1298	980	0.692	0.676	GRIK5_HUMAN Glutamate receptor ionotropic, kainate 5 OS=Homo sapiens OX=9606 GN=GRIK5 PE=2 SV=2
16	Q38PU0	1285	891	0.660	0.708	Q38PU0_MACFA Glutamate receptor (Fragment) OS=Macaca fascicularis OX=9541 GN=GRIK5 PE=2 SV=1
17	Q38PU2	705	919	0.391	0.407	GRIK3_MACFA Glutamate receptor ionotropic, kainate 3 OS=Macaca fascicularis OX=9541 GN=GRIK3 PE=2 SV=1
18	Q38PU3	724	908	0.411	0.433	GRIK2_MACFA Glutamate receptor ionotropic, kainate 2 OS=Macaca fascicularis OX=9541 GN=GRIK2 PE=2 SV=1
19	Q61626	1300	979	0.685	0.669	GRIK5_MOUSE Glutamate receptor ionotropic, kainate 5 OS=Mus musculus OX=10090 GN=Grik5 PE=2 SV=2
20	Q63273	1300	979	0.685	0.669	GRIK5_RAT Glutamate receptor ionotropic, kainate 5 OS=Rattus norvegicus OX=10116 GN=Grik5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01094 ANF_receptor	1.5e-58	210.2	Receptor family ligand binding region
2	PF00060 Lig_chan	6.8e-45	164.0	Ligand-gated ion channel
3	PF10613 Lig_chan-Glu_bd	6e-41	150.6	Ligated ion channel L-glutamate- and glycine-binding site
4	PF00497 SBP_bac_3	3.1e-17	74.3	Bacterial extracellular solute-binding proteins, family 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000435648

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000440556	0.840	Metabotropic glutamate receptor 4
2	9606.ENSP00000382428	0.831	Disks large homolog 4
3	9606.ENSP00000262891	0.826	MAP/microtubule affinity-regulating kinase 4
4	9606.ENSP00000354896	0.791	Metabotropic glutamate receptor 1
5	9606.ENSP00000325448	0.773	Lysine--tRNA ligase
6	9606.ENSP00000300105	0.755	Voltage-dependent calcium channel gamma-2 subunit
7	9606.ENSP00000397026	0.746	Glutamate receptor ionotropic, kainate 2
8	9606.ENSP00000360608	0.730	Glutamate receptor ionotropic, NMDA 1
9	9606.ENSP00000362183	0.729	Glutamate receptor ionotropic, kainate 3
10	9606.ENSP00000379818	0.728	Glutamate receptor ionotropic, NMDA 2A
11	9606.ENSP00000270458	0.721	Voltage-dependent calcium channel gamma-8 subunit
12	9606.ENSP00000293190	0.719	Glutamate receptor ionotropic, NMDA 2C
13	9606.ENSP00000477455	0.710	Glutamate receptor ionotropic, NMDA 2B
14	9606.ENSP00000355155	0.706	Glutamate receptor ionotropic, NMDA 3A
15	9606.ENSP00000263269	0.705	Glutamate receptor ionotropic, NMDA 2D
16	9606.ENSP00000363480	0.702	Disks large homolog 3
17	9606.ENSP00000234389	0.698	Glutamate receptor ionotropic, NMDA 3B
18	9606.ENSP00000262138	0.697	Voltage-dependent calcium channel gamma-4 subunit
19	9606.ENSP00000382791	0.684	Glutamate receptor ionotropic, kainate 1
20	9606.ENSP00000375647	0.681	Voltage-dependent calcium channel gamma-7 subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0099094	1.000	ligand-gated monoatomic cation channel activity
GO:0005272	1.000	sodium channel activity
GO:0005267	1.000	potassium channel activity
GO:0004970	1.000	ionotropic glutamate receptor activity
GO:0005515	0.997	protein binding
GO:0015277	0.631	kainate selective glutamate receptor activity
GO:0099507	0.614	ligand-gated monoatomic ion channel activity involved in regulation of presynaptic membrane potential
GO:0005244	0.486	voltage-gated monoatomic ion channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0023052	0.996	signaling
GO:0007154	0.996	cell communication
GO:0065007	0.981	biological regulation
GO:0050896	0.976	response to stimulus
GO:0050794	0.966	regulation of cellular process
GO:0007267	0.958	cell-cell signaling
GO:0051716	0.952	cellular response to stimulus
GO:0007268	0.947	chemical synaptic transmission
GO:0007165	0.533	signal transduction
GO:0051179	0.516	localization
GO:0032501	0.479	multicellular organismal process
GO:0051234	0.461	establishment of localization
GO:0006810	0.437	transport
GO:0006811	0.393	monoatomic ion transport
GO:0065008	0.322	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.998	organelle
GO:0045202	0.997	synapse
GO:0043235	0.995	receptor complex
GO:0098797	0.995	plasma membrane protein complex
GO:0034702	0.995	ion channel complex
GO:0008328	0.985	ionotropic glutamate receptor complex
GO:0098590	0.957	plasma membrane region
GO:0005622	0.954	intracellular anatomical structure
GO:0043231	0.944	intracellular membrane-bounded organelle
GO:0097060	0.926	synaptic membrane
GO:0034703	0.892	cation channel complex
GO:0005737	0.862	cytoplasm
GO:0098793	0.820	presynapse
GO:0042734	0.775	presynaptic membrane
GO:0030425	0.704	dendrite
GO:0098794	0.570	postsynapse
GO:0012505	0.468	endomembrane system
GO:0098984	0.427	neuron to neuron synapse
GO:0098978	0.398	glutamatergic synapse
GO:0045211	0.388	postsynaptic membrane
GO:0005634	0.352	nucleus
GO:0043025	0.350	neuronal cell body
GO:0014069	0.328	postsynaptic density

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]