StarFunc result for job id Q16134

User Input

>input (617 residues)
MLVPLAKLSCLAYQCFHALKIKKNYLPLCATRWSSTSTVPRITTHYTIYPRDKDKRWEGV
NMERFAEEADVVIVGAGPAGLSAAVRLKQLAVAHEKDIRVCLVEKAAQIGAHTLSGACLD
PGAFKELFPDWKEKGAPLNTPVTEDRFGILTEKYRIPVPILPGLPMNNHGNYIVRLGHLV
SWMGEQAEALGVEVYPGYAAAEVLFHDDGSVKGIATNDVGIQKDGAPKATFERGLELHAK
VTIFAEGCHGHLAKQLYKKFDLRANCEPQTYGIGLKELWVIDEKNWKPGRVDHTVGWPLD
RHTYGGSFLYHLNEGEPLVALGLVVGLDYQNPYLSPFREFQRWKHHPSIRPTLEGGKRIA
YGARALNEGGFQSIPKLTFPGGLLIGCSPGFMNVPKIKGTHTAMKSGILAAESIFNQLTS
ENLQSKTIGLHVTEYEDNLKNSWVWKELYSVRNIRPSCHGVLGVYGGMIYTGIFYWILRG
MEPWTLKHKGSDFERLKPAKDCTPIEYPKPDGQISFDLLSSVALSGTNHEHDQPAHLTLR
DDSIPVNRNLSIYDGPEQRFCPAGVYEFVPVEQGDGFRLQINAQNCVHCKTCDIKDPSQN
INWVVPEGGGGPAYNGM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:2gmhA	0.939	0.997	0.000	581	0.898	0.954	2gmhA.pdb.gz	Structure of electron transfer flavoprotein-ubiquinone oxidoreductase and electron transfer to the mitochondrial ubiquinone pool.
2	AFDB:P55931	0.966	0.966	0.000	617	0.950	0.950	P55931.pdb.gz	ETFD_PIG Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Sus scrofa OX=9823 GN=ETFDH PE=1 SV=2
3	AFDB:Q66I16	0.943	0.943	0.000	617	0.802	0.802	Q66I16.pdb.gz	Q66I16_DANRE Electron transfer flavoprotein-ubiquinone oxidoreductase OS=Danio rerio OX=7955 GN=zgc:92093 PE=1 SV=1
4	AFDB:Q7JWF1	0.926	0.945	3.073E-99	604	0.639	0.652	Q7JWF1.pdb.gz	Q7JWF1_DROME Electron transfer flavoprotein-ubiquinone oxidoreductase OS=Drosophila melanogaster OX=7227 GN=Etf-QO PE=1 SV=1
5	AFDB:Q11190	0.916	0.947	1.518E-94	597	0.587	0.606	Q11190.pdb.gz	ETFD_CAEEL Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=let-721 PE=3 SV=2
6	AFDB:O22854	0.869	0.847	4.692E-83	633	0.512	0.499	O22854.pdb.gz	ETFQO_ARATH Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ETFQO PE=2 SV=1
7	AFDB:Q08822	0.887	0.868	1.937E-80	631	0.507	0.496	Q08822.pdb.gz	ETFD_YEAST Probable electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CIR2 PE=1 SV=1
8	AFDB:Q3J5K9	0.863	0.965	3.088E-77	551	0.454	0.508	Q3J5K9.pdb.gz	Q3J5K9_CERS4 Electron transfer flavoprotein-ubiquinone oxidoreductase OS=Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) OX=272943 GN=RSP_1777 PE=4 SV=1
9	AFDB:P68644	0.527	0.747	4.853E-24	428	0.160	0.231	P68644.pdb.gz	FIXC_ECOLI Protein FixC OS=Escherichia coli (strain K12) OX=83333 GN=fixC PE=3 SV=1
10	AFDB:Q9CA67	0.432	0.558	7.903E-17	467	0.125	0.165	Q9CA67.pdb.gz	CHLP_ARATH Geranylgeranyl diphosphate reductase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CHLP PE=1 SV=1
11	AFDB:Q14534	0.423	0.450	1.839E-16	574	0.133	0.143	Q14534.pdb.gz	ERG1_HUMAN Squalene monooxygenase OS=Homo sapiens OX=9606 GN=SQLE PE=1 SV=3
12	PDB:5dbjE	0.442	0.599	1.189E-15	437	0.133	0.188	5dbjE.pdb.gz	Crystal structure of halogenase PltA from the pyoluteorin biosynthetic pathway.
13	PDB:5wgrA	0.405	0.381	1.782E-13	664	0.120	0.111	5wgrA.pdb.gz	Function and Structure of MalA/MalA', Iterative Halogenases for Late-Stage C-H Functionalization of Indole Alkaloids.
14	PDB:3ihgA	0.373	0.422	4.639E-13	535	0.089	0.103	3ihgA.pdb.gz	Structural basis for substrate recognition and specificity in aklavinone-11-hydroxylase from rhodomycin biosynthesis.
15	PDB:3c96A	0.412	0.623	4.908E-13	381	0.120	0.194	3c96A.pdb.gz	Crystal structure of the flavin-containing monooxygenase phzS from Pseudomonas aeruginosa.
16	PDB:4k22A	0.375	0.599	1.142E-12	354	0.099	0.172	4k22A.pdb.gz
17	PDB:5fn0A	0.370	0.477	3.145E-12	455	0.102	0.138	5fn0A.pdb.gz	Kynurenine-3-Monooxygenase Inhibition Prevents Multiple Organ Failure in Rodent Models of Acute Pancreatitis.
18	PDB:1d7lA	0.396	0.570	4.934E-12	394	0.104	0.162	1d7lA.pdb.gz	Structure-function correlations of the reaction of reduced nicotinamide analogues with p-hydroxybenzoate hydroxylase substituted with a series of 8-substituted flavins.
19	PDB:7on9A	0.430	0.632	7.741E-12	393	0.075	0.117	7on9A.pdb.gz	Debottlenecking 4-hydroxybenzoate hydroxylation in Pseudomonas putida KT2440 improves muconate productivity from p-coumarate.
20	PDB:2dkiA	0.401	0.402	8.663E-12	615	0.102	0.102	2dkiA.pdb.gz	Crystal structure of 3-hydroxybenzoate hydroxylase from Comamonas testosteroni has a large tunnel for substrate and oxygen access to the active site

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O22854	0.0	612	633	0.486	0.474	ETFQO_ARATH Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=ETFQO PE=2 SV=1
2	P55931	0.0	1233	617	0.950	0.950	ETFD_PIG Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Sus scrofa OX=9823 GN=ETFDH PE=1 SV=2
3	Q08822	0.0	583	631	0.496	0.485	ETFD_YEAST Probable electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CIR2 PE=1 SV=1
4	Q11190	0.0	758	597	0.590	0.610	ETFD_CAEEL Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=let-721 PE=3 SV=2
5	Q16134	0.0	1281	617	1.000	1.000	ETFD_HUMAN Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=ETFDH PE=1 SV=2
6	Q3J5K9	0.0	553	551	0.462	0.517	Q3J5K9_CERS4 Electron transfer flavoprotein-ubiquinone oxidoreductase OS=Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) OX=272943 GN=RSP_1777 PE=4 SV=1
7	Q66I16	0.0	1065	617	0.804	0.804	Q66I16_DANRE Electron transfer flavoprotein-ubiquinone oxidoreductase OS=Danio rerio OX=7955 GN=zgc:92093 PE=1 SV=1
8	Q6UPE1	0.0	1194	616	0.932	0.933	ETFD_RAT Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Etfdh PE=1 SV=1
9	Q7JWF1	0.0	843	604	0.642	0.656	Q7JWF1_DROME Electron transfer flavoprotein-ubiquinone oxidoreductase OS=Drosophila melanogaster OX=7227 GN=Etf-QO PE=1 SV=1
10	Q921G7	0.0	1187	616	0.924	0.925	ETFD_MOUSE Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial OS=Mus musculus OX=10090 GN=Etfdh PE=1 SV=1
11	P68644	1.70e-22	102	428	0.167	0.241	FIXC_ECOLI Protein FixC OS=Escherichia coli (strain K12) OX=83333 GN=fixC PE=3 SV=1
12	C8VD04	0.005	42.4	463	0.055	0.073	C8VD04_EMENI NADPH-dependent FMN reductase Lot6, putative (AFU_orthologue AFUA_7G06600) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_07214 PE=4 SV=1
13	Q4WR24	0.012	41.2	596	0.036	0.037	HELE_ASPFU 3-ketosteroid 1-dehydrogenase helE OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=helE PE=1 SV=1
14	Q02733	0.18	37.4	499	0.031	0.038	IRC15_YEAST Increased recombination centers protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IRC15 PE=1 SV=1
15	Q46905	0.18	34.3	86	0.031	0.221	YGCO_ECOLI Ferredoxin-like protein YgcO OS=Escherichia coli (strain K12) OX=83333 GN=ygcO PE=3 SV=2
16	Q803L1	0.20	37.0	507	0.037	0.045	Q803L1_DANRE Dihydrolipoyl dehydrogenase OS=Danio rerio OX=7955 GN=fb24b05 PE=1 SV=1
17	P32318	0.26	36.6	326	0.031	0.058	THI4_YEAST Thiamine thiazole synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=THI4 PE=1 SV=1
18	P09624	0.29	36.6	499	0.037	0.046	DLDH_YEAST Dihydrolipoyl dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LPD1 PE=1 SV=1
19	Q6SSJ6	0.32	36.6	639	0.031	0.030	MOBA_COMTE 3-hydroxybenzoate 4-monooxygenase OS=Comamonas testosteroni OX=285 GN=mobA PE=1 SV=1
20	Q5LRA7	0.33	36.2	464	0.034	0.045	Q5LRA7_RUEPO Dihydrolipoyl dehydrogenase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) OX=246200 GN=SPO2222 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01262 AlaDh_PNT_C	3.4e+02	11.9	Alanine dehydrogenase/PNT, C-terminal domain
2	PF01266 DAO	3.4e-05	35.2	FAD dependent oxidoreductase
3	PF05187 ETF_QO	6.8e-46	166.0	Electron transfer flavoprotein-ubiquinone oxidoreductase, 4Fe-4S
4	PF00890 FAD_binding_2	0.00013	32.8	FAD binding domain
5	PF01494 FAD_binding_3	0.33	21.8	FAD binding domain
6	PF12831 FAD_oxidored	11	16.9	FAD dependent oxidoreductase
7	PF12838 Fer4_7	42	16.2	4Fe-4S dicluster domain
8	PF01134 GIDA	3.4e+02	11.7	Glucose inhibited division protein A
9	PF03486 HI0933_like	2.5	18.4	HI0933-like protein
10	PF05834 Lycopene_cycl	0.068	23.8	Lycopene cyclase protein
11	PF13434 Lys_Orn_oxgnase	5.7e+02	11.0	L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase
12	PF13450 NAD_binding_8	0.0024	29.4	NAD(P)-binding Rossmann-like domain
13	PF13454 NAD_binding_9	1.6	20.3	FAD-NAD(P)-binding
14	PF00070 Pyr_redox	2.1	20.2	Pyridine nucleotide-disulphide oxidoreductase
15	PF07992 Pyr_redox_2	0.094	23.5	Pyridine nucleotide-disulphide oxidoreductase
16	PF13738 Pyr_redox_3	20	15.9	Pyridine nucleotide-disulphide oxidoreductase
17	PF01946 Thi4	7.6e-05	33.6	Thi4 family
18	PF04820 Trp_halogenase	36	14.7	Tryptophan halogenase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000426638

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000346173	0.999	Electron transfer flavoprotein subunit beta
2	9606.ENSP00000452762	0.999	Electron transfer flavoprotein subunit alpha, mitochondrial
3	9606.ENSP00000325136	0.940	hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta
4	9606.ENSP00000233710	0.852	Long-chain specific acyl-CoA dehydrogenase, mitochondrial
5	9606.ENSP00000418397	0.852	Isovaleryl-CoA dehydrogenase, mitochondrial
6	9606.ENSP00000360541	0.845	Carnitine O-palmitoyltransferase 2, mitochondrial
7	9606.ENSP00000438689	0.830	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial
8	9606.ENSP00000359871	0.827	Medium-chain specific acyl-CoA dehydrogenase, mitochondrial
9	9606.ENSP00000365388	0.818	Decaprenyl-diphosphate synthase subunit 1
10	9606.ENSP00000262507	0.811	Ubiquinone biosynthesis protein COQ9, mitochondrial
11	9606.ENSP00000399979	0.808	Solute carrier family 52, riboflavin transporter, member 1
12	9606.ENSP00000358033	0.805	Decaprenyl-diphosphate synthase subunit 2
13	9606.ENSP00000242592	0.781	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
14	9606.ENSP00000310873	0.781	4-hydroxybenzoate polyprenyltransferase, mitochondrial
15	9606.ENSP00000370023	0.771	Trifunctional enzyme subunit alpha, mitochondrial
16	9606.ENSP00000381785	0.769	Hydroxysteroid dehydrogenase-like protein 2
17	9606.ENSP00000222214	0.764	Glutaryl-CoA dehydrogenase, mitochondrial
18	9606.ENSP00000285093	0.749	3-ketoacyl-CoA thiolase, mitochondrial
19	9606.ENSP00000436768	0.741	Solute carrier family 52, riboflavin transporter, member 2
20	9606.ENSP00000220764	0.735	2,4-dienoyl-CoA reductase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0009055	1.000	electron transfer activity
GO:0051539	1.000	4 iron, 4 sulfur cluster binding
GO:0016649	1.000	oxidoreductase activity, acting on the CH-NH group of donors, quinone or similar compound as acceptor
GO:0048038	0.999	quinone binding
GO:0004174	0.982	electron-transferring-flavoprotein dehydrogenase activity
GO:1901363	0.975	heterocyclic compound binding
GO:0097159	0.975	organic cyclic compound binding
GO:0050660	0.966	flavin adenine dinucleotide binding
GO:0048039	0.858	ubiquinone binding
GO:0005515	0.822	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.996	cellular metabolic process
GO:0022900	0.959	electron transport chain
GO:0071704	0.912	organic substance metabolic process
GO:0044238	0.784	primary metabolic process
GO:0044281	0.741	small molecule metabolic process
GO:0019752	0.442	carboxylic acid metabolic process
GO:0046395	0.404	carboxylic acid catabolic process
GO:0032787	0.359	monocarboxylic acid metabolic process
GO:0006631	0.334	fatty acid metabolic process
GO:0015980	0.328	energy derivation by oxidation of organic compounds
GO:0045333	0.320	cellular respiration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005739	1.000	mitochondrion
GO:0070013	0.999	intracellular organelle lumen
GO:0031090	0.992	organelle membrane
GO:0031966	0.983	mitochondrial membrane
GO:0019866	0.947	organelle inner membrane
GO:0005743	0.943	mitochondrial inner membrane
GO:0005759	0.942	mitochondrial matrix
GO:0031981	0.343	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.5.5.-	1.000	With a quinone or similar compound as acceptor.
RHEA:24052	0.982	a ubiquinone + reduced [electron-transfer flavoprotein] = a ubiquinol + H(+) + oxidized [electron-transfer flavoprotein]
EC:1.5.5.1	0.982	electron-transferring-flavoprotein dehydrogenase.

[back to server]