StarFunc result for job id Q16186

User Input

>input (407 residues)
MTTSGALFPSLVPGSRGASNKYLVEFRAGKMSLKGTTVTPDKRKGLVYIQQTDDSLIHFC
WKDRTSGNVEDDLIIFPDDCEFKRVPQCPSGRVYVLKFKAGSKRLFFWMQEPKTDQDEEH
CRKVNEYLNNPPMPGALGASGSSGHELSALGGEGGLQSLLGNMSHSQLMQLIGPAGLGGL
GGLGALTGPGLASLLGSSGPPGSSSSSSSRSQSAAVTPSSTTSSTRATPAPSAPAAASAT
SPSPAPSSGNGASTAASPTQPIQLSDLQSILATMNVPAGPAGGQQVDLASVLTPEIMAPI
LANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFG
LPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16186	1.000	1.000	1.418E-65	407	1.000	1.000	Q16186.pdb.gz	ADRM1_HUMAN Proteasomal ubiquitin receptor ADRM1 OS=Homo sapiens OX=9606 GN=ADRM1 PE=1 SV=2
2	PDB:2kr0A	0.295	0.295	7.670E-48	407	1.000	1.000	2kr0A.pdb.gz
3	AFDB:Q09289	0.281	0.305	9.412E-26	374	0.327	0.356	Q09289.pdb.gz	ADRM1_CAEEL Proteasomal ubiquitin receptor ADRM1 homolog OS=Caenorhabditis elegans OX=6239 GN=rpn-13 PE=1 SV=2
4	AFDB:O48726	0.275	0.370	1.322E-21	300	0.297	0.403	O48726.pdb.gz	RPN13_ARATH 26S proteasome regulatory subunit RPN13 OS=Arabidopsis thaliana OX=3702 GN=RPN13 PE=1 SV=2
5	AFDB:Q9USM1	0.290	0.304	7.475E-16	388	0.248	0.260	Q9USM1.pdb.gz	RP13B_SCHPO Proteasomal ubiquitin receptor ADRM1 homolog rpn1302 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpn1302 PE=1 SV=1
6	AFDB:Q556N5	0.265	0.371	3.277E-15	287	0.199	0.282	Q556N5.pdb.gz	ADRM1_DICDI Proteasomal ubiquitin receptor ADRM1 homolog OS=Dictyostelium discoideum OX=44689 GN=adrm1-1 PE=1 SV=1
7	AFDB:G9CGD6	0.222	0.105	8.350E-6	899	0.165	0.075	G9CGD6.pdb.gz	CNIPF_HUMAN CNK3/IPCEF1 fusion protein OS=Homo sapiens OX=9606 GN=CNK3/IPCEF1 PE=1 SV=1
8	AFDB:Q8T4F7	0.223	0.102	1.748E-5	980	0.106	0.044	Q8T4F7.pdb.gz	ENA_DROME Protein enabled OS=Drosophila melanogaster OX=7227 GN=ena PE=1 SV=4
9	AFDB:E9QIX7	0.203	0.205	2.074E-5	402	0.118	0.119	E9QIX7.pdb.gz	E9QIX7_DANRE Pleckstrin homology domain-containing, family O member 1b OS=Danio rerio OX=7955 GN=plekho1b PE=4 SV=1
10	AFDB:Q9VZZ9	0.211	0.104	9.623E-5	878	0.108	0.050	Q9VZZ9.pdb.gz	DOS_DROME Protein daughter of sevenless OS=Drosophila melanogaster OX=7227 GN=dos PE=1 SV=1
11	AFDB:O01683	0.151	0.096	1.279E-4	689	0.115	0.068	O01683.pdb.gz	SSP1B_CAEEL FACT complex subunit ssrp1-B OS=Caenorhabditis elegans OX=6239 GN=hmg-3 PE=1 SV=1
12	PDB:1k5dB	0.214	0.527	2.428E-4	146	0.044	0.123	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
13	PDB:6am0F	0.219	0.450	7.569E-4	178	0.047	0.107	6am0F.pdb.gz	Structure of the activated Edc1-Dcp1-Dcp2-Edc3 mRNA decapping complex with substrate analog poised for catalysis.
14	PDB:2qkmG	0.203	0.544	1.065E-3	127	0.027	0.087	2qkmG.pdb.gz	Structural basis of dcp2 recognition and activation by dcp1.
15	PDB:3m1iB	0.221	0.574	1.990E-3	131	0.039	0.122	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
16	PDB:1q67B	0.224	0.514	2.106E-3	161	0.034	0.087	1q67B.pdb.gz
17	PDB:6oxlN	0.186	0.486	5.535E-3	124	0.039	0.129	6oxlN.pdb.gz	A structural mechanism for phosphorylation-dependent inactivation of the AP2 complex.
18	PDB:7o4i1	0.195	0.154	6.948E-3	522	0.034	0.027	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
19	PDB:6hhgA	0.176	0.184	1.725E-2	386	0.037	0.039	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
20	PDB:3pvuA	0.174	0.124	1.826E-2	609	0.032	0.021	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WX59	0.0	712	368	0.904	1.000	A0A087WX59_HUMAN ADRM1 26S proteasome ubiquitin receptor OS=Homo sapiens OX=9606 GN=ADRM1 PE=1 SV=1
2	Q16186	0.0	821	407	1.000	1.000	ADRM1_HUMAN Proteasomal ubiquitin receptor ADRM1 OS=Homo sapiens OX=9606 GN=ADRM1 PE=1 SV=2
3	Q9JKV1	0.0	791	407	0.966	0.966	ADRM1_MOUSE Proteasomal ubiquitin receptor ADRM1 OS=Mus musculus OX=10090 GN=Adrm1 PE=1 SV=2
4	Q7K2G1	3.93e-90	279	389	0.391	0.409	ADRM1_DROME Proteasomal ubiquitin receptor ADRM1 homolog OS=Drosophila melanogaster OX=7227 GN=Rpn13 PE=1 SV=1
5	Q09289	1.85e-57	194	374	0.344	0.374	ADRM1_CAEEL Proteasomal ubiquitin receptor ADRM1 homolog OS=Caenorhabditis elegans OX=6239 GN=rpn-13 PE=1 SV=2
6	O48726	4.29e-41	149	300	0.177	0.240	RPN13_ARATH 26S proteasome regulatory subunit RPN13 OS=Arabidopsis thaliana OX=3702 GN=RPN13 PE=1 SV=2
7	Q9USM1	2.69e-28	116	388	0.160	0.168	RP13B_SCHPO Proteasomal ubiquitin receptor ADRM1 homolog rpn1302 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpn1302 PE=1 SV=1
8	Q9Y7Y6	4.09e-21	94.7	291	0.101	0.141	RP13A_SCHPO Proteasomal ubiquitin receptor ADRM1 homolog rpn1301 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpn1301 PE=1 SV=1
9	Q556N5	5.95e-17	82.8	287	0.098	0.139	ADRM1_DICDI Proteasomal ubiquitin receptor ADRM1 homolog OS=Dictyostelium discoideum OX=44689 GN=adrm1-1 PE=1 SV=1
10	Q38D00	8.54e-14	72.8	251	0.113	0.183	Q38D00_TRYB2 Pru domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.244.2850 PE=4 SV=1
11	O97267	0.001	43.5	2114	0.054	0.010	O97267_PLAF7 Circumsporozoite- and TRAP-related protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0315200 PE=4 SV=1
12	O13563	0.50	33.9	156	0.064	0.167	RPN13_YEAST 26S proteasome regulatory subunit RPN13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPN13 PE=1 SV=1
13	B7Z002	2.4	33.1	5517	0.047	0.003	B7Z002_DROME Kismet, isoform C OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
14	M9NEL3	2.4	33.1	5191	0.047	0.004	M9NEL3_DROME Kismet, isoform F OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
15	M9NCY5	2.5	33.1	5343	0.047	0.004	M9NCY5_DROME Kismet, isoform D OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
16	Q9VPL9	2.5	33.1	5322	0.047	0.004	Q9VPL9_DROME FI24801p1 OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=3
17	M9NDB7	2.6	33.1	5252	0.047	0.004	M9NDB7_DROME Kismet, isoform E OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1
18	E9PHV5	3.3	32.7	1237	0.118	0.039	E9PHV5_HUMAN ITPR interacting domain containing 2 OS=Homo sapiens OX=9606 GN=ITPRID2 PE=1 SV=1
19	Q9Y1L3	3.3	32.7	2151	0.047	0.009	Q9Y1L3_DROME Kismet OS=Drosophila melanogaster OX=7227 GN=kis PE=2 SV=1
20	Q9VPL6	3.5	32.7	2151	0.047	0.009	Q9VPL6_DROME Kismet, isoform B OS=Drosophila melanogaster OX=7227 GN=kis PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13919 ASXH	67	14.9	Asx homology domain
2	PF17898 GerD	1.3e+02	13.9	Spore germination GerD central core domain
3	PF04683 Proteasom_Rpn13	1.8e-28	110.2	Proteasome complex subunit Rpn13 ubiquitin receptor
4	PF16550 RPN13_C	2e-31	119.9	UCH-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000478877

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000157812	0.999	26S proteasome regulatory subunit 6B
2	9606.ENSP00000215071	0.999	26S proteasome non-ATPase regulatory subunit 8
3	9606.ENSP00000219313	0.999	26S proteasome non-ATPase regulatory subunit 7
4	9606.ENSP00000261303	0.999	26S proteasome regulatory subunit 4
5	9606.ENSP00000261712	0.999	26S proteasome non-ATPase regulatory subunit 11
6	9606.ENSP00000264639	0.999	26S proteasome non-ATPase regulatory subunit 3
7	9606.ENSP00000309474	0.999	26S proteasome non-ATPase regulatory subunit 1
8	9606.ENSP00000310129	0.999	26S proteasome non-ATPase regulatory subunit 2
9	9606.ENSP00000310572	0.999	26S proteasome regulatory subunit 8
10	9606.ENSP00000348442	0.999	26S proteasome non-ATPase regulatory subunit 12
11	9606.ENSP00000356425	0.999	Ubiquitin carboxyl-terminal hydrolase isozyme L5
12	9606.ENSP00000357879	0.999	26S proteasome non-ATPase regulatory subunit 4
13	9606.ENSP00000386541	0.999	26S proteasome non-ATPase regulatory subunit 14
14	9606.ENSP00000391211	0.999	26S proteasome regulatory subunit 7
15	9606.ENSP00000396937	0.999	Proteasome 26S subunit, non-ATPase 13
16	9606.ENSP00000401802	0.999	26S proteasome regulatory subunit 10B
17	9606.ENSP00000414359	0.999	Proteasome subunit alpha type-1
18	9606.ENSP00000418695	0.999	Proteasome 26S subunit, non-ATPase 6
19	9606.ENSP00000481029	0.999	26S proteasome regulatory subunit 6A
20	9606.ENSP00000044462	0.998	Proteasome subunit alpha type-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0002020	0.987	protease binding
GO:0044877	0.932	protein-containing complex binding
GO:0061134	0.908	peptidase regulator activity
GO:0070628	0.904	proteasome binding
GO:0061133	0.896	endopeptidase activator activity
GO:0140678	0.885	molecular function inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.989	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0009059	0.964	macromolecule biosynthetic process
GO:0034641	0.959	cellular nitrogen compound metabolic process
GO:0016043	0.938	cellular component organization
GO:0044271	0.934	cellular nitrogen compound biosynthetic process
GO:0010467	0.911	gene expression
GO:0065007	0.852	biological regulation
GO:1901360	0.850	organic cyclic compound metabolic process
GO:0006725	0.845	cellular aromatic compound metabolic process
GO:0006139	0.833	nucleobase-containing compound metabolic process
GO:0050789	0.772	regulation of biological process
GO:0090304	0.738	nucleic acid metabolic process
GO:0050794	0.735	regulation of cellular process
GO:0043933	0.735	protein-containing complex organization
GO:0044085	0.697	cellular component biogenesis
GO:1901564	0.626	organonitrogen compound metabolic process
GO:0006354	0.593	DNA-templated transcription elongation
GO:0006366	0.576	transcription by RNA polymerase II
GO:0019538	0.572	protein metabolic process
GO:0022607	0.539	cellular component assembly
GO:0048518	0.537	positive regulation of biological process
GO:0048522	0.532	positive regulation of cellular process
GO:0050896	0.511	response to stimulus
GO:0065003	0.428	protein-containing complex assembly
GO:0044260	0.395	cellular macromolecule metabolic process
GO:0048583	0.356	regulation of response to stimulus
GO:0006368	0.324	transcription elongation by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0005886	0.999	plasma membrane
GO:0140535	0.984	intracellular protein-containing complex
GO:1905368	0.981	peptidase complex
GO:1905369	0.932	endopeptidase complex
GO:0000502	0.912	proteasome complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]