StarFunc result for job id Q16222

User Input

>input (522 residues)
MNINDLKLTLSKAGQEHLLRFWNELEEAQQVELYAELQAMNFEELNFFFQKAIEGFNQSS
HQKNVDARMEPVPREVLGSATRDQDQLQAWESEGLFQISQNKVAVLLLAGGQGTRLGVAY
PKGMYDVGLPSRKTLFQIQAERILKLQQVAEKYYGNKCIIPWYIMTSGRTMESTKEFFTK
HKYFGLKKENVIFFQQGMLPAMSFDGKIILEEKNKVSMAPDGNGGLYRALAAQNIVEDME
QRGIWSIHVYCVDNILVKVADPRFIGFCIQKGADCGAKVVEKTNPTEPVGVVCRVDGVYQ
VVEYSEISLATAQKRSSDGRLLFNAGNIANHFFTVPFLRDVVNVYEPQLQHHVAQKKIPY
VDTQGQLIKPDKPNGIKMEKFVFDIFQFAKKFVVYEVLREDEFSPLKNADSQNGKDNPTT
ARHALMSLHHCWVLNAGGHFIDENGSRLPAIPRSATNGKSETITADVNHNLKDANDVPIQ
CEISPLISYAGEGLESYVADKEFHAPLIIDENGVHELVKNGI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16222	1.000	1.000	0.000	522	1.000	1.000	Q16222.pdb.gz	UAP1_HUMAN UDP-N-acetylhexosamine pyrophosphorylase OS=Homo sapiens OX=9606 GN=UAP1 PE=1 SV=3
2	PDB:1jv1A	0.934	0.995	1.731E-100	490	0.939	1.000	1jv1A.pdb.gz	Crystal structures of two human pyrophosphorylase isoforms in complexes with UDPGlc(Gal)NAc: role of the alternatively spliced insert in the enzyme oligomeric assembly and active site architecture.
3	AFDB:Q8IGT8	0.877	0.855	1.465E-70	536	0.487	0.474	Q8IGT8.pdb.gz	Q8IGT8_DROME RE31673p (Fragment) OS=Drosophila melanogaster OX=7227 GN=mmy PE=2 SV=1
4	AFDB:A0A1D8PNG6	0.836	0.896	4.641E-57	486	0.385	0.414	A0A1D8PNG6.pdb.gz	A0A1D8PNG6_CANAL UDP-N-acetylglucosamine diphosphorylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UAP1 PE=4 SV=1
5	AFDB:P43123	0.844	0.921	6.769E-56	477	0.368	0.403	P43123.pdb.gz	UAP1_YEAST UDP-N-acetylglucosamine pyrophosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=QRI1 PE=1 SV=1
6	AFDB:Q940S3	0.842	0.869	1.468E-55	505	0.377	0.390	Q940S3.pdb.gz	UAP1_ARATH UDP-N-acetylglucosamine diphosphorylase 1 OS=Arabidopsis thaliana OX=3702 GN=GLCNAC1PUT1 PE=1 SV=1
7	AFDB:O64765	0.839	0.872	1.755E-55	502	0.389	0.404	O64765.pdb.gz	UAP2_ARATH UDP-N-acetylglucosamine diphosphorylase 2 OS=Arabidopsis thaliana OX=3702 GN=GLCNAC1PUT2 PE=1 SV=1
8	AFDB:O94617	0.800	0.876	1.384E-49	475	0.322	0.354	O94617.pdb.gz	UAP1_SCHPO Probable UDP-N-acetylglucosamine pyrophosphorylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uap1 PE=1 SV=1
9	AFDB:Q386Q8	0.787	0.755	2.775E-44	545	0.314	0.301	Q386Q8.pdb.gz	Q386Q8_TRYB2 UDP-N-acetylglucosamine pyrophosphorylase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0120 PE=1 SV=1
10	PDB:4bqhA	0.766	0.767	1.083E-43	521	0.314	0.315	4bqhA.pdb.gz	A Novel Allosteric Inhibitor of the Uridine Diphosphate N-Acetylglucosamine Pyrophosphorylase from Trypanosoma Brucei.
11	AFDB:Q9C5I1	0.716	0.617	2.780E-29	614	0.209	0.178	Q9C5I1.pdb.gz	USP_ARATH UDP-sugar pyrophosphorylase OS=Arabidopsis thaliana OX=3702 GN=USP PE=1 SV=1
12	AFDB:F4IY62	0.748	0.455	2.235E-28	883	0.170	0.101	F4IY62.pdb.gz	UGPA3_ARATH UTP--glucose-1-phosphate uridylyltransferase 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=UGP3 PE=1 SV=1
13	PDB:2i5kB	0.508	0.566	2.814E-22	466	0.126	0.142	2i5kB.pdb.gz
14	PDB:2icyB	0.515	0.575	3.365E-22	463	0.146	0.164	2icyB.pdb.gz	Structure and Dynamics of UDP-Glucose Pyrophosphorylase from Arabidopsis thaliana with Bound UDP-Glucose and UTP.
15	PDB:4r7pA	0.562	0.602	4.270E-22	485	0.140	0.151	4r7pA.pdb.gz	A Quaternary Mechanism Enables the Complex Biological Functions of Octameric Human UDP-glucose Pyrophosphorylase, a Key Enzyme in Cell Metabolism.
16	PDB:3r2wC	0.496	0.568	2.308E-20	450	0.138	0.160	3r2wC.pdb.gz
17	PDB:4j18A	0.510	0.546	6.742E-20	485	0.136	0.146	4j18A.pdb.gz
18	PDB:3gueA	0.519	0.575	1.152E-19	468	0.119	0.132	3gueA.pdb.gz	Crystal Structure of UDP-glucose phosphorylase from Trypanosoma Brucei, (Tb10.389.0330)
19	PDB:3d8vA	0.386	0.418	2.656E-10	478	0.090	0.098	3d8vA.pdb.gz	Structure and function of GlmU from Mycobacterium tuberculosis.
20	PDB:2oi6B	0.354	0.403	1.682E-9	452	0.096	0.111	2oi6B.pdb.gz	Structure of the E. coli bifunctional GlmU acetyltransferase active site with substrates and products.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VKC0	0.0	1042	505	0.967	1.000	A0A140VKC0_HUMAN Testis tissue sperm-binding protein Li 37a OS=Homo sapiens OX=9606 PE=2 SV=1
2	D3ZF39	0.0	1019	521	0.933	0.935	D3ZF39_RAT UDP-N-acetylglucosamine pyrophosphorylase 1 OS=Rattus norvegicus OX=10116 GN=Uap1 PE=1 SV=2
3	Q16222	0.0	1088	522	1.000	1.000	UAP1_HUMAN UDP-N-acetylhexosamine pyrophosphorylase OS=Homo sapiens OX=9606 GN=UAP1 PE=1 SV=3
4	Q8IPJ6	1.98e-177	509	483	0.487	0.526	Q8IPJ6_DROME Mummy, isoform B OS=Drosophila melanogaster OX=7227 GN=mmy PE=1 SV=1
5	Q9Y0Z0	2.39e-177	511	520	0.487	0.488	Q9Y0Z0_DROME LD24639p OS=Drosophila melanogaster OX=7227 GN=mmy PE=1 SV=1
6	Q8IGT8	1.09e-176	510	536	0.487	0.474	Q8IGT8_DROME RE31673p (Fragment) OS=Drosophila melanogaster OX=7227 GN=mmy PE=2 SV=1
7	O64765	3.06e-115	352	502	0.395	0.410	UAP2_ARATH UDP-N-acetylglucosamine diphosphorylase 2 OS=Arabidopsis thaliana OX=3702 GN=GLCNAC1PUT2 PE=1 SV=1
8	A0A1D8PNG6	3.25e-111	340	486	0.381	0.409	A0A1D8PNG6_CANAL UDP-N-acetylglucosamine diphosphorylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=UAP1 PE=4 SV=1
9	Q940S3	5.83e-111	340	505	0.383	0.396	UAP1_ARATH UDP-N-acetylglucosamine diphosphorylase 1 OS=Arabidopsis thaliana OX=3702 GN=GLCNAC1PUT1 PE=1 SV=1
10	P43123	1.01e-110	339	477	0.352	0.386	UAP1_YEAST UDP-N-acetylglucosamine pyrophosphorylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=QRI1 PE=1 SV=1
11	O94617	9.75e-85	272	475	0.316	0.347	UAP1_SCHPO Probable UDP-N-acetylglucosamine pyrophosphorylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=uap1 PE=1 SV=1
12	Q386Q8	3.33e-76	251	545	0.335	0.321	Q386Q8_TRYB2 UDP-N-acetylglucosamine pyrophosphorylase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0120 PE=1 SV=1
13	Q9C5I1	7.45e-11	67.0	614	0.163	0.138	USP_ARATH UDP-sugar pyrophosphorylase OS=Arabidopsis thaliana OX=3702 GN=USP PE=1 SV=1
14	P78811	1.64e-10	65.9	506	0.148	0.152	UGPA1_SCHPO Probable UTP--glucose-1-phosphate uridylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fyu1 PE=1 SV=2
15	O59819	3.45e-09	61.6	499	0.123	0.128	UGPA2_SCHPO Probable UTP--glucose-1-phosphate uridylyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC794.10 PE=3 SV=1
16	Q54YZ0	2.88e-08	58.5	502	0.109	0.114	UGPA2_DICDI UTP--glucose-1-phosphate uridylyltransferase 2 OS=Dictyostelium discoideum OX=44689 GN=ugpB PE=2 SV=1
17	Q4V8I9	7.58e-07	53.9	508	0.151	0.156	Q4V8I9_RAT UTP--glucose-1-phosphate uridylyltransferase OS=Rattus norvegicus OX=10116 GN=Ugp2 PE=1 SV=1
18	Q91ZJ5	8.86e-07	53.9	508	0.151	0.156	UGPA_MOUSE UTP--glucose-1-phosphate uridylyltransferase OS=Mus musculus OX=10090 GN=Ugp2 PE=1 SV=3
19	Q9FHG3	2.14e-06	52.8	653	0.056	0.044	Q9FHG3_ARATH 16S rRNA processing protein RimM family OS=Arabidopsis thaliana OX=3702 GN=At5g46420 PE=1 SV=1
20	Q16851	3.86e-06	52.0	508	0.153	0.157	UGPA_HUMAN UTP--glucose-1-phosphate uridylyltransferase OS=Homo sapiens OX=9606 GN=UGP2 PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12804 NTP_transf_3	1.2e+02	14.5	MobA-like NTP transferase domain
2	PF01704 UDPGP	6.5e-91	316.6	UTP--glucose-1-phosphate uridylyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000002677

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000031409	0.999	Phosphoacetylglucosamine mutase
2	9598.ENSPTRP00000035798	0.988	Uncharacterized protein
3	9598.ENSPTRP00000000588	0.987	Belongs to the NAD(P)-dependent epimerase/dehydratase family
4	9598.ENSPTRP00000056935	0.909	UDP-glucose pyrophosphorylase 2
5	9598.ENSPTRP00000059130	0.831	Galactokinase 2
6	9598.ENSPTRP00000035894	0.811	Phosphoglucomutase 5
7	9598.ENSPTRP00000048622	0.805	UDP-N-acteylglucosamine pyrophosphorylase 1-like 1
8	9598.ENSPTRP00000036202	0.771	Asparagine-linked glycosylation 2, alpha-1,3-mannosyltransferase homolog
9	9598.ENSPTRP00000016406	0.764	Uncharacterized protein
10	9598.ENSPTRP00000010769	0.756	Glucosamine-phosphate N-acetyltransferase 1
11	9598.ENSPTRP00000001415	0.755	Uncharacterized protein
12	9598.ENSPTRP00000006629	0.706	Alpha-1,4 glucan phosphorylase
13	9598.ENSPTRP00000010744	0.706	Alpha-1,4 glucan phosphorylase
14	9598.ENSPTRP00000047621	0.701	Pleckstrin homology domain containing, family M, member 3
15	9598.ENSPTRP00000020669	0.699	Uncharacterized protein
16	9598.ENSPTRP00000002684	0.690	Discoidin domain receptor tyrosine kinase 2
17	9598.ENSPTRP00000035725	0.680	Belongs to the galactose-1-phosphate uridylyltransferase type 1 family
18	9598.ENSPTRP00000014127	0.677	Uncharacterized protein
19	9598.ENSPTRP00000048808	0.671	Serine/threonine-protein phosphatase 2A activator
20	9598.ENSPTRP00000031497	0.667	Splicing factor, arginine/serine-rich 18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.998	binding
GO:0003977	0.998	UDP-N-acetylglucosamine diphosphorylase activity
GO:0005515	0.994	protein binding
GO:0042802	0.932	identical protein binding
GO:0036094	0.331	small molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006793	0.991	phosphorus metabolic process
GO:0009225	0.988	nucleotide-sugar metabolic process
GO:0006040	0.962	amino sugar metabolic process
GO:1901137	0.939	carbohydrate derivative biosynthetic process
GO:0009226	0.859	nucleotide-sugar biosynthetic process
GO:0046349	0.685	amino sugar biosynthetic process
GO:0006047	0.341	UDP-N-acetylglucosamine metabolic process
GO:0043170	0.323	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005634	0.961	nucleus
GO:0016020	0.957	membrane
GO:0005886	0.940	plasma membrane
GO:0070013	0.918	intracellular organelle lumen
GO:0031981	0.886	nuclear lumen
GO:0005654	0.873	nucleoplasm
GO:0012505	0.557	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13509	0.998	H(+) + N-acetyl-alpha-D-glucosamine 1-phosphate + UTP = diphosphate + UDP-N-acetyl-alpha-D-glucosamine
EC:2.7.7.23	0.998	UDP-N-acetylglucosamine diphosphorylase.

[back to server]