StarFunc result for job id Q16236

User Input

>input (605 residues)
MMDLELPPPGLPSQQDMDLIDILWRQDIDLGVSREVFDFSQRRKEYELEKQKKLEKERQE
QLQKEQEKAFFAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCM
QLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVAQVAPVDLDGM
QQDIEQVWEELLSIPELQCLNIENDKLVETTMVPSPEAKLTEVDNYHFYSSIPSMEKEVG
NCSPHFLNAFEDSFSSILSTEDPNQLTVNSLNSDATVNTDFGDEFYSAFIAEPSISNSMP
SPATLSHSLSELLNGPIDVSDLSLCKAFNQNHPESTAEFNDSDSGISLNTSPSVASPEHS
VESSSYGDTLLGLSDSEVEELDSAPGSVKQNGPKTPVHSSGDMVQPLSPSQGQSTHVHDA
QCENTPEKELPVSPGHRKTPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVVD
FNEMMSKEQFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLDHLKDEKEKLL
KEKGENDKSLHLLKKQLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKP
DVKKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16236	1.000	1.000	1.820E-92	605	1.000	1.000	Q16236.pdb.gz	NF2L2_HUMAN Nuclear factor erythroid 2-related factor 2 OS=Homo sapiens OX=9606 GN=NFE2L2 PE=1 SV=3
2	AFDB:O54968	0.520	0.521	1.064E-73	604	0.828	0.829	O54968.pdb.gz	NF2L2_RAT Nuclear factor erythroid 2-related factor 2 OS=Rattus norvegicus OX=10116 GN=Nfe2l2 PE=1 SV=2
3	AFDB:A7YYH1	0.335	0.345	4.095E-39	586	0.455	0.469	A7YYH1.pdb.gz
4	AFDB:Q14494	0.297	0.236	5.131E-27	772	0.327	0.256	Q14494.pdb.gz	NF2L1_HUMAN Endoplasmic reticulum membrane sensor NFE2L1 OS=Homo sapiens OX=9606 GN=NFE2L1 PE=1 SV=1
5	AFDB:P20482	0.255	0.116	2.842E-12	1383	0.195	0.085	P20482.pdb.gz	CNC_DROME Segmentation protein cap'n'collar OS=Drosophila melanogaster OX=7227 GN=cnc PE=2 SV=3
6	AFDB:Q9BYV9	0.176	0.129	3.973E-6	841	0.180	0.130	Q9BYV9.pdb.gz	BACH2_HUMAN Transcription regulator protein BACH2 OS=Homo sapiens OX=9606 GN=BACH2 PE=1 SV=1
7	AFDB:Q59DN5	0.095	0.093	1.200E-3	618	0.134	0.131	Q59DN5.pdb.gz	Q59DN5_DROME FI18025p1 OS=Drosophila melanogaster OX=7227 GN=Sox102F PE=2 SV=1
8	AFDB:Q9VIW0	0.171	0.197	6.659E-3	511	0.114	0.135	Q9VIW0.pdb.gz	Q9VIW0_DROME Traffic jam, isoform B OS=Drosophila melanogaster OX=7227 GN=tj PE=4 SV=3
9	AFDB:Q57YV4	0.113	0.069	9.145E-3	1028	0.094	0.055	Q57YV4.pdb.gz	Q57YV4_TRYB2 Kinetoplast-associated protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.440 PE=4 SV=1
10	AFDB:Q9VB74	0.082	0.101	1.106E-2	463	0.086	0.112	Q9VB74.pdb.gz	NKAP_DROME NKAP family protein CG6066 OS=Drosophila melanogaster OX=7227 GN=CG6066 PE=1 SV=1
11	PDB:5y86A	0.036	0.053	7.575E-1	395	0.013	0.020	5y86A.pdb.gz	Crystal Structure of Human Dual-Specificity Tyrosine-Regulated Kinase 3 Reveals New Structural Features and Insights into its Auto-phosphorylation
12	PDB:2w1tA	0.035	0.102	1.341	175	0.018	0.063	2w1tA.pdb.gz
13	PDB:1qr0A	0.032	0.076	1.522	228	0.012	0.031	1qr0A.pdb.gz	Crystal structure of the surfactin synthetase-activating enzyme sfp: a prototype of the 4'-phosphopantetheinyl transferase superfamily.
14	PDB:1fthA	0.043	0.163	1.622	117	0.012	0.060	1fthA.pdb.gz	Crystal structure of Streptococcus pneumoniae acyl carrier protein synthase: an essential enzyme in bacterial fatty acid biosynthesis.
15	PDB:3sucA	0.039	0.032	1.728	767	0.021	0.017	3sucA.pdb.gz	Crystallographic Insights Into the Autocatalytic Assembly Mechanism of a Bacteriophage Tail Spike
16	PDB:7pntU	0.115	0.313	2.091	174	0.036	0.126	7pntU.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
17	PDB:1c0gA	0.031	0.049	2.872	368	0.007	0.011	1c0gA.pdb.gz	Structural basis for the higher Ca(2+)-activation of the regulated actin-activated myosin ATPase observed with Dictyostelium/Tetrahymena actin chimeras.
18	PDB:6pwnA	0.062	0.107	3.060	280	0.035	0.075	6pwnA.pdb.gz
19	PDB:1gxdC	0.037	0.107	3.260	192	0.005	0.016	1gxdC.pdb.gz	Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
20	PDB:7ls2Q2	0.044	0.197	3.260	110	0.012	0.064	7ls2Q2.pdb.gz	Functionally distinct roles for eEF2K in the control of ribosome availability and p-body abundance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9J1A8	0.0	575	280	0.463	1.000	C9J1A8_HUMAN Nuclear factor erythroid 2-related factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=NFE2L2 PE=1 SV=1
2	K7EIW5	0.0	1205	604	0.975	0.977	K7EIW5_HUMAN NFE2 like bZIP transcription factor 2 OS=Homo sapiens OX=9606 GN=NFE2L2 PE=1 SV=2
3	O54968	0.0	1011	604	0.828	0.829	NF2L2_RAT Nuclear factor erythroid 2-related factor 2 OS=Rattus norvegicus OX=10116 GN=Nfe2l2 PE=1 SV=2
4	Q16236	0.0	1237	605	1.000	1.000	NF2L2_HUMAN Nuclear factor erythroid 2-related factor 2 OS=Homo sapiens OX=9606 GN=NFE2L2 PE=1 SV=3
5	Q60795	0.0	982	597	0.812	0.822	NF2L2_MOUSE Nuclear factor erythroid 2-related factor 2 OS=Mus musculus OX=10090 GN=Nfe2l2 PE=1 SV=2
6	C9J0Y1	4.09e-170	484	234	0.387	1.000	C9J0Y1_HUMAN Nuclear factor erythroid 2-related factor 2 (Fragment) OS=Homo sapiens OX=9606 GN=NFE2L2 PE=1 SV=1
7	Q8JIM1	7.56e-141	423	586	0.458	0.473	Q8JIM1_DANRE Nuclear factor erythroid 2-related factor 2 OS=Danio rerio OX=7955 GN=nrf2 PE=2 SV=1
8	Q16621	1.19e-58	202	373	0.208	0.338	NFE2_HUMAN Transcription factor NF-E2 45 kDa subunit OS=Homo sapiens OX=9606 GN=NFE2 PE=1 SV=1
9	Q07279	4.78e-55	193	373	0.149	0.241	NFE2_MOUSE Transcription factor NF-E2 45 kDa subunit OS=Mus musculus OX=10090 GN=Nfe2 PE=1 SV=1
10	Q7ZZR2	5.23e-54	191	419	0.197	0.284	Q7ZZR2_DANRE NFE2 OS=Danio rerio OX=7955 GN=nfe2 PE=2 SV=1
11	J3QKY3	2.88e-52	190	573	0.145	0.154	J3QKY3_HUMAN NFE2 like bZIP transcription factor 1 OS=Homo sapiens OX=9606 GN=NFE2L1 PE=1 SV=1
12	J9JIE5	3.37e-51	190	761	0.145	0.116	J9JIE5_HUMAN NFE2 like bZIP transcription factor 1 OS=Homo sapiens OX=9606 GN=NFE2L1 PE=1 SV=1
13	Q14494	4.24e-51	190	772	0.145	0.114	NF2L1_HUMAN Endoplasmic reticulum membrane sensor NFE2L1 OS=Homo sapiens OX=9606 GN=NFE2L1 PE=1 SV=1
14	Q9Y4A8	3.40e-44	169	694	0.134	0.117	NF2L3_HUMAN Nuclear factor erythroid 2-related factor 3 OS=Homo sapiens OX=9606 GN=NFE2L3 PE=1 SV=1
15	Q9WTM4	1.68e-42	164	660	0.124	0.114	NF2L3_MOUSE Nuclear factor erythroid 2-related factor 3 OS=Mus musculus OX=10090 GN=Nfe2l3 PE=1 SV=1
16	P20482	5.95e-39	156	1383	0.124	0.054	CNC_DROME Segmentation protein cap'n'collar OS=Drosophila melanogaster OX=7227 GN=cnc PE=2 SV=3
17	G8DKA8	2.16e-37	147	507	0.117	0.140	G8DKA8_DANRE Nrf2b OS=Danio rerio OX=7955 GN=Nrf2b PE=2 SV=1
18	F6TNN0	4.51e-36	147	922	0.122	0.080	F6TNN0_CIOIN BZIP domain-containing protein OS=Ciona intestinalis OX=7719 GN=nf-e2 PE=1 SV=2
19	A7SQR2	5.16e-21	91.7	146	0.088	0.363	A7SQR2_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g127893 PE=1 SV=1
20	P97303	1.20e-17	89.4	839	0.076	0.055	BACH2_MOUSE Transcription regulator protein BACH2 OS=Mus musculus OX=10090 GN=Bach2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	6.5e-05	34.3	bZIP transcription factor
2	PF07716 bZIP_2	0.13	23.7	Basic region leucine zipper
3	PF03131 bZIP_Maf	1.5e-12	59.2	bZIP Maf transcription factor
4	PF18466 GluRS_N	4.6e+02	12.6	Glutamate--tRNA ligase N-terminal domain
5	PF17001 T3SS_basalb_I	2.6e+02	13.6	Type III secretion basal body protein I, YscI, HrpB, PscI

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380252

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000171111	0.999	Kelch-like ECH-associated protein 1
2	9606.ENSP00000350369	0.999	Transcription factor MafG
3	9606.ENSP00000360266	0.999	Transcription factor AP-1
4	9606.ENSP00000344903	0.998	Transcription factor MafK
5	9606.ENSP00000345393	0.995	Transcription factor MafF
6	9606.ENSP00000264414	0.993	Cullin-3
7	9606.ENSP00000327048	0.993	Transcription factor Maf
8	9606.ENSP00000216117	0.991	Heme oxygenase 1
9	9606.ENSP00000336790	0.974	Cyclic AMP-dependent transcription factor ATF-4
10	9606.ENSP00000399805	0.972	Quinone oxidoreductase
11	9606.ENSP00000387699	0.960	Cyclic AMP-responsive element-binding protein 1
12	9606.ENSP00000477572	0.950	Heme oxygenase 2
13	9606.ENSP00000420168	0.946	Glutathione S-transferase A2
14	9606.ENSP00000306245	0.945	Proto-oncogene c-Fos
15	9606.ENSP00000357256	0.945	Polyamine-modulated factor 1
16	9606.ENSP00000303174	0.941	UDP-glucuronosyltransferase 1-6
17	9606.ENSP00000307235	0.939	Eukaryotic translation initiation factor 2-alpha kinase 3
18	9606.ENSP00000408695	0.937	Protein kinase C alpha type
19	9606.ENSP00000235835	0.928	Aflatoxin B1 aldehyde reductase member 2
20	9606.ENSP00000448665	0.920	DNA damage-inducible transcript 3 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0008134	1.000	transcription factor binding
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0019904	0.981	protein domain specific binding
GO:0140297	0.907	DNA-binding transcription factor binding
GO:0061629	0.891	RNA polymerase II-specific DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0050896	0.996	response to stimulus
GO:0051716	0.992	cellular response to stimulus
GO:0044237	0.992	cellular metabolic process
GO:0048522	0.992	positive regulation of cellular process
GO:0071704	0.991	organic substance metabolic process
GO:0006355	0.990	regulation of DNA-templated transcription
GO:0042221	0.985	response to chemical
GO:0009893	0.985	positive regulation of metabolic process
GO:0033554	0.983	cellular response to stress
GO:0070887	0.982	cellular response to chemical stimulus
GO:0048583	0.980	regulation of response to stimulus
GO:0007165	0.978	signal transduction
GO:0045893	0.978	positive regulation of DNA-templated transcription
GO:0010033	0.970	response to organic substance
GO:0080134	0.969	regulation of response to stress
GO:0006979	0.965	response to oxidative stress
GO:0071310	0.953	cellular response to organic substance
GO:0080135	0.943	regulation of cellular response to stress
GO:0034976	0.942	response to endoplasmic reticulum stress
GO:1902882	0.940	regulation of response to oxidative stress
GO:0042981	0.938	regulation of apoptotic process
GO:0062197	0.931	cellular response to chemical stress
GO:0045944	0.930	positive regulation of transcription by RNA polymerase II
GO:0060548	0.925	negative regulation of cell death
GO:1900407	0.923	regulation of cellular response to oxidative stress
GO:0043069	0.920	negative regulation of programmed cell death
GO:0043066	0.911	negative regulation of apoptotic process
GO:0044238	0.869	primary metabolic process
GO:0048584	0.857	positive regulation of response to stimulus
GO:0034599	0.857	cellular response to oxidative stress
GO:0006807	0.846	nitrogen compound metabolic process
GO:1901031	0.846	regulation of response to reactive oxygen species
GO:1901700	0.840	response to oxygen-containing compound
GO:0042592	0.827	homeostatic process
GO:0019725	0.790	cellular homeostasis
GO:0009056	0.783	catabolic process
GO:1901701	0.762	cellular response to oxygen-containing compound
GO:0045454	0.761	cell redox homeostasis
GO:1901575	0.744	organic substance catabolic process
GO:0009966	0.703	regulation of signal transduction
GO:0009628	0.700	response to abiotic stimulus
GO:0043170	0.688	macromolecule metabolic process
GO:0036294	0.678	cellular response to decreased oxygen levels
GO:0048585	0.674	negative regulation of response to stimulus
GO:0010035	0.673	response to inorganic substance
GO:1901564	0.673	organonitrogen compound metabolic process
GO:0034097	0.673	response to cytokine
GO:0051246	0.665	regulation of protein metabolic process
GO:0034612	0.659	response to tumor necrosis factor
GO:0034620	0.659	cellular response to unfolded protein
GO:0023057	0.651	negative regulation of signaling
GO:0019538	0.607	protein metabolic process
GO:0051247	0.605	positive regulation of protein metabolic process
GO:0010648	0.594	negative regulation of cell communication
GO:0043618	0.593	regulation of transcription from RNA polymerase II promoter in response to stress
GO:0036003	0.559	positive regulation of transcription from RNA polymerase II promoter in response to stress
GO:0010628	0.529	positive regulation of gene expression
GO:0006984	0.520	ER-nucleus signaling pathway
GO:1902531	0.487	regulation of intracellular signal transduction
GO:0044248	0.468	cellular catabolic process
GO:0051239	0.441	regulation of multicellular organismal process
GO:0009892	0.435	negative regulation of metabolic process
GO:0043412	0.432	macromolecule modification
GO:0009968	0.427	negative regulation of signal transduction
GO:0010605	0.426	negative regulation of macromolecule metabolic process
GO:0051172	0.404	negative regulation of nitrogen compound metabolic process
GO:0031324	0.386	negative regulation of cellular metabolic process
GO:0036211	0.351	protein modification process
GO:0009719	0.344	response to endogenous stimulus
GO:0009410	0.343	response to xenobiotic stimulus
GO:0071345	0.331	cellular response to cytokine stimulus
GO:0032502	0.327	developmental process
GO:0071356	0.306	cellular response to tumor necrosis factor
GO:0030968	0.305	endoplasmic reticulum unfolded protein response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.996	nucleoplasm
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0016020	0.988	membrane
GO:0005886	0.982	plasma membrane
GO:0032991	0.965	protein-containing complex
GO:0012505	0.812	endomembrane system
GO:0005856	0.774	cytoskeleton
GO:0005667	0.755	transcription regulator complex
GO:0015630	0.663	microtubule cytoskeleton
GO:0005815	0.547	microtubule organizing center
GO:0005813	0.515	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]