StarFunc result for job id Q16254

User Input

>input (413 residues)
MAEAGPQAPPPPGTPSRHEKSLGLLTTKFVSLLQEAKDGVLDLKLAADTLAVRQKRRIYD
ITNVLEGIGLIEKKSKNSIQWKGVGPGCNTREIADKLIELKAEIEELQQREQELDQHKVW
VQQSIRNVTEDVQNSCLAYVTHEDICRCFAGDTLLAIRAPSGTSLEVPIPEGLNGQKKYQ
IHLKSVSGPIEVLLVNKEAWSSPPVAVPVPPPEDLLQSPSAVSTPPPLPKPALAQSQEAS
RPNSPQLTPTAVPGSAEVQGMAGPAAEITVSGGPGTDSKDSGELSSLPLGPTTLDTRPLQ
SSALLDSSSSSSSSSSSSSNSNSSSSSGPNPSTSFEPIKADPTGVLELPKELSEIFDPTR
ECMSSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCDLFDVPVLNL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q16254	1.000	1.000	5.486E-65	413	1.000	1.000	Q16254.pdb.gz	E2F4_HUMAN Transcription factor E2F4 OS=Homo sapiens OX=9606 GN=E2F4 PE=1 SV=2
2	AFDB:Q15329	0.468	0.553	5.316E-34	346	0.516	0.616	Q15329.pdb.gz	E2F5_HUMAN Transcription factor E2F5 OS=Homo sapiens OX=9606 GN=E2F5 PE=1 SV=1
3	AFDB:P56931	0.283	0.266	4.000E-20	443	0.327	0.305	P56931.pdb.gz	E2F2_MOUSE Transcription factor E2F2 OS=Mus musculus OX=10090 GN=E2f2 PE=1 SV=2
4	AFDB:Q14209	0.273	0.260	2.136E-19	437	0.324	0.307	Q14209.pdb.gz	E2F2_HUMAN Transcription factor E2F2 OS=Homo sapiens OX=9606 GN=E2F2 PE=1 SV=1
5	AFDB:Q9FV71	0.298	0.266	7.386E-19	469	0.288	0.254	Q9FV71.pdb.gz	E2FB_ARATH Transcription factor E2FB OS=Arabidopsis thaliana OX=3702 GN=E2FB PE=1 SV=1
6	AFDB:O00716	0.283	0.258	1.748E-17	465	0.300	0.267	O00716.pdb.gz	E2F3_HUMAN Transcription factor E2F3 OS=Homo sapiens OX=9606 GN=E2F3 PE=1 SV=1
7	AFDB:Q27368	0.239	0.136	4.281E-12	805	0.322	0.165	Q27368.pdb.gz	E2F1_DROME Transcription factor E2f1 OS=Drosophila melanogaster OX=7227 GN=E2f1 PE=1 SV=2
8	AFDB:A0AVK6	0.149	0.072	3.777E-3	867	0.245	0.116	A0AVK6.pdb.gz	E2F8_HUMAN Transcription factor E2F8 OS=Homo sapiens OX=9606 GN=E2F8 PE=1 SV=1
9	PDB:6hixBN	0.134	0.233	3.602E-2	214	0.053	0.103	6hixBN.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
10	PDB:6hivBN	0.134	0.233	7.127E-2	214	0.053	0.103	6hivBN.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
11	PDB:3jckF	0.147	0.155	8.585E-2	388	0.036	0.039	3jckF.pdb.gz	Atomic structure of the 26S proteasome lid reveals the mechanism of deubiquitinase inhibition.
12	PDB:4ev0D	0.134	0.244	1.501E-1	214	0.019	0.037	4ev0D.pdb.gz	Crystal Structure of T. thermophilius Catabolite Activator Protein
13	PDB:5l4kO	0.146	0.158	1.501E-1	376	0.029	0.032	5l4kO.pdb.gz
14	AFDB:P41813	0.135	0.072	1.562E-1	862	0.157	0.075	P41813.pdb.gz	FKH2_YEAST Fork head protein homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FKH2 PE=1 SV=1
15	PDB:1tw2B	0.126	0.146	1.807E-1	350	0.029	0.034	1tw2B.pdb.gz	Crystal structure of a ternary complex of DnrK, a methyltransferase in daunorubicin biosynthesis, with bound products
16	PDB:6r7fC	0.129	0.131	2.046E-1	403	0.029	0.030	6r7fC.pdb.gz
17	PDB:1lnwB	0.122	0.313	2.317E-1	139	0.048	0.144	1lnwB.pdb.gz
18	PDB:5znxA	0.132	0.437	2.317E-1	95	0.024	0.105	5znxA.pdb.gz
19	PDB:1jhfA	0.122	0.233	2.465E-1	197	0.027	0.056	1jhfA.pdb.gz
20	AFDB:Q6GNV6	0.120	0.067	2.567E-1	856	0.196	0.095	Q6GNV6.pdb.gz	CTIP_XENLA DNA endonuclease RBBP8 OS=Xenopus laevis OX=8355 GN=rbbp8 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q16254	0.0	825	413	1.000	1.000	E2F4_HUMAN Transcription factor E2F4 OS=Homo sapiens OX=9606 GN=E2F4 PE=1 SV=2
2	Q8R0K9	0.0	628	410	0.925	0.932	E2F4_MOUSE Transcription factor E2F4 OS=Mus musculus OX=10090 GN=E2f4 PE=1 SV=1
3	Q6DE14	4.00e-174	493	375	0.656	0.723	E2F4_XENLA Transcription factor E2F4 OS=Xenopus laevis OX=8355 GN=e2f4 PE=1 SV=1
4	Q15329	2.87e-105	317	346	0.402	0.480	E2F5_HUMAN Transcription factor E2F5 OS=Homo sapiens OX=9606 GN=E2F5 PE=1 SV=1
5	Q62814	5.55e-105	314	300	0.419	0.577	E2F5_RAT Transcription factor E2F5 (Fragment) OS=Rattus norvegicus OX=10116 GN=E2f5 PE=2 SV=1
6	Q61502	1.11e-104	315	335	0.438	0.540	E2F5_MOUSE Transcription factor E2F5 OS=Mus musculus OX=10090 GN=E2f5 PE=1 SV=2
7	Q9FV71	1.03e-47	171	469	0.228	0.200	E2FB_ARATH Transcription factor E2FB OS=Arabidopsis thaliana OX=3702 GN=E2FB PE=1 SV=1
8	Q9FNY0	3.57e-46	167	485	0.232	0.198	E2FA_ARATH Transcription factor E2FA OS=Arabidopsis thaliana OX=3702 GN=E2FA PE=1 SV=1
9	Q9FV70	1.81e-44	160	396	0.220	0.230	E2FC_ARATH Transcription factor E2FC OS=Arabidopsis thaliana OX=3702 GN=E2FC PE=1 SV=1
10	P56931	8.05e-44	160	443	0.257	0.239	E2F2_MOUSE Transcription factor E2F2 OS=Mus musculus OX=10090 GN=E2f2 PE=1 SV=2
11	Q14209	1.33e-43	159	437	0.237	0.224	E2F2_HUMAN Transcription factor E2F2 OS=Homo sapiens OX=9606 GN=E2F2 PE=1 SV=1
12	O35261	1.03e-41	155	457	0.266	0.241	E2F3_MOUSE Transcription factor E2F3 OS=Mus musculus OX=10090 GN=E2f3 PE=1 SV=2
13	O00716	1.29e-41	154	465	0.237	0.211	E2F3_HUMAN Transcription factor E2F3 OS=Homo sapiens OX=9606 GN=E2F3 PE=1 SV=1
14	G5EF11	1.94e-41	151	342	0.208	0.251	G5EF11_CAEEL E2F/DP family winged-helix DNA-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=efl-1 PE=1 SV=1
15	F4ILT1	8.24e-38	145	514	0.215	0.173	F4ILT1_ARATH E2F transcription factor 3 OS=Arabidopsis thaliana OX=3702 GN=E2F3 PE=1 SV=1
16	Q01094	2.53e-34	134	437	0.201	0.190	E2F1_HUMAN Transcription factor E2F1 OS=Homo sapiens OX=9606 GN=E2F1 PE=1 SV=1
17	O54917	2.46e-32	125	272	0.186	0.283	E2F6_MOUSE Transcription factor E2F6 OS=Mus musculus OX=10090 GN=E2f6 PE=2 SV=2
18	H0YBK0	1.15e-30	118	182	0.169	0.385	H0YBK0_HUMAN E2F transcription factor 5 (Fragment) OS=Homo sapiens OX=9606 GN=E2F5 PE=1 SV=1
19	A0A0S2Z3K8	2.02e-30	120	281	0.177	0.260	A0A0S2Z3K8_HUMAN E2F transcription factor 6 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=E2F6 PE=2 SV=1
20	O75461	2.02e-30	120	281	0.177	0.260	E2F6_HUMAN Transcription factor E2F6 OS=Homo sapiens OX=9606 GN=E2F6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04977 DivIC	1.3e+02	13.8	Septum formation initiator
2	PF16421 E2F_CC-MB	5.2e-29	111.7	E2F transcription factor CC-MB domain
3	PF02319 E2F_TDP	4.1e-22	89.1	E2F/DP family winged-helix DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368686

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262133	0.999	Retinoblastoma-like protein 2
2	9606.ENSP00000267163	0.999	Retinoblastoma-associated protein
3	9606.ENSP00000332973	0.999	Mothers against decapentaplegic homolog 3
4	9606.ENSP00000362768	0.999	Retinoblastoma-like protein 1
5	9606.ENSP00000364519	0.999	Transcription factor Dp-1
6	9606.ENSP00000420616	0.999	Transcription factor Dp-2
7	9606.ENSP00000362649	0.998	Histone deacetylase 1
8	9606.ENSP00000427514	0.998	CCAAT/enhancer-binding protein alpha
9	9606.ENSP00000217026	0.994	Myb-related protein B
10	9606.ENSP00000329102	0.994	Protein lin-9 homolog
11	9606.ENSP00000257904	0.986	Cyclin-dependent kinase 4
12	9606.ENSP00000426359	0.984	Multicilin
13	9606.ENSP00000266970	0.978	Cyclin-dependent kinase 2
14	9606.ENSP00000341551	0.978	Mothers against decapentaplegic homolog 4
15	9606.ENSP00000341947	0.978	Protein lin-54 homolog
16	9606.ENSP00000378402	0.978	Paired amphipathic helix protein Sin3a
17	9606.ENSP00000265734	0.976	Cyclin-dependent kinase 6
18	9606.ENSP00000227507	0.975	G1/S-specific cyclin-D1
19	9606.ENSP00000228872	0.973	Cyclin-dependent kinase inhibitor 1B
20	9606.ENSP00000378699	0.973	Cyclin-dependent kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:0000978	1.000	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.998	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0019904	0.928	protein domain specific binding
GO:1990841	0.922	promoter-specific chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.996	regulation of DNA-templated transcription
GO:0048518	0.994	positive regulation of biological process
GO:0031325	0.975	positive regulation of cellular metabolic process
GO:0051173	0.973	positive regulation of nitrogen compound metabolic process
GO:0010604	0.973	positive regulation of macromolecule metabolic process
GO:0006357	0.946	regulation of transcription by RNA polymerase II
GO:0045935	0.937	positive regulation of nucleobase-containing compound metabolic process
GO:0045893	0.916	positive regulation of DNA-templated transcription
GO:0009987	0.911	cellular process
GO:0045944	0.902	positive regulation of transcription by RNA polymerase II
GO:0048519	0.418	negative regulation of biological process
GO:0050896	0.405	response to stimulus
GO:0048523	0.354	negative regulation of cellular process
GO:0051726	0.344	regulation of cell cycle
GO:0071840	0.336	cellular component organization or biogenesis
GO:0032502	0.324	developmental process
GO:0016043	0.322	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	1.000	nucleoplasm
GO:0005694	0.985	chromosome
GO:0000785	0.982	chromatin
GO:0032991	0.963	protein-containing complex
GO:0005829	0.905	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]