StarFunc result for job id Q16288

User Input

>input (839 residues)
MDVSLCPAKCSFWRIFLLGSVWLDYVGSVLACPANCVCSKTEINCRRPDDGNLFPLLEGQ
DSGNSNGNASINITDISRNITSIHIENWRSLHTLNAVDMELYTGLQKLTIKNSGLRSIQP
RAFAKNPHLRYINLSSNRLTTLSWQLFQTLSLRELQLEQNFFNCSCDIRWMQLWQEQGEA
KLNSQNLYCINADGSQLPLFRMNISQCDLPEISVSHVNLTVREGDNAVITCNGSGSPLPD
VDWIVTGLQSINTHQTNLNWTNVHAINLTLVNVTSEDNGFTLTCIAENVVGMSNASVALT
VYYPPRVVSLEEPELRLEHCIEFVVRGNPPPTLHWLHNGQPLRESKIIHVEYYQEGEISE
GCLLFNKPTHYNNGNYTLIAKNPLGTANQTINGHFLKEPFPESTDNFILFDEVSPTPPIT
VTHKPEEDTFGVSIAVGLAAFACVLLVVLFVMINKYGRRSKFGMKGPVAVISGEEDSASP
LHHINHGITTPSSLDAGPDTVVIGMTRIPVIENPQYFRQGHNCHKPDTYVQHIKRRDIVL
KRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHI
VKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPDAMILVDGQPRQAKGELGLSQMLHIA
SQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGMSRDVYSTDYYRLFNPSGNDF
CIWCEVGGHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVI
ECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0H2UKW5	0.485	0.499	0.000	813	0.702	0.724	A0A0H2UKW5.pdb.gz	A0A0H2UKW5_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=ntrk3b PE=3 SV=5
2	AFDB:A0A0R4ITE7	0.480	0.489	0.000	821	0.731	0.747	A0A0R4ITE7.pdb.gz
3	AFDB:Q03351	0.621	0.607	0.000	864	0.973	0.944	Q03351.pdb.gz	NTRK3_RAT NT-3 growth factor receptor OS=Rattus norvegicus OX=10116 GN=Ntrk3 PE=1 SV=2
4	AFDB:Q16288	1.000	1.000	0.000	839	1.000	1.000	Q16288.pdb.gz	NTRK3_HUMAN NT-3 growth factor receptor OS=Homo sapiens OX=9606 GN=NTRK3 PE=1 SV=2
5	AFDB:A0A0R4ITX7	0.433	0.451	1.076E-102	801	0.518	0.543	A0A0R4ITX7.pdb.gz
6	AFDB:Q91987	0.437	0.448	4.493E-102	818	0.551	0.565	Q91987.pdb.gz	NTRK2_CHICK BDNF/NT-3 growth factors receptor OS=Gallus gallus OX=9031 GN=NTRK2 PE=1 SV=1
7	AFDB:A0A024R230	0.491	0.492	8.689E-102	838	0.539	0.539	A0A024R230.pdb.gz
8	AFDB:F6P1M3	0.454	0.475	3.875E-99	797	0.502	0.528	F6P1M3.pdb.gz	F6P1M3_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=trk PE=3 SV=1
9	AFDB:P04629	0.402	0.421	7.021E-91	796	0.491	0.518	P04629.pdb.gz	NTRK1_HUMAN High affinity nerve growth factor receptor OS=Homo sapiens OX=9606 GN=NTRK1 PE=1 SV=4
10	AFDB:P35739	0.396	0.414	1.043E-88	799	0.472	0.496	P35739.pdb.gz	NTRK1_RAT High affinity nerve growth factor receptor OS=Rattus norvegicus OX=10116 GN=Ntrk1 PE=1 SV=1
11	PDB:2h8hA	0.286	0.524	3.397E-23	445	0.119	0.225	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:4fl2A	0.281	0.418	7.789E-22	555	0.111	0.168	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:4k2rA	0.280	0.421	6.287E-21	551	0.112	0.171	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
14	PDB:1k9aB	0.282	0.529	4.547E-20	441	0.107	0.204	1k9aB.pdb.gz
15	PDB:7mfdA	0.267	0.515	2.418E-15	410	0.097	0.198	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
16	PDB:4zhxA	0.264	0.518	3.552E-15	409	0.095	0.196	4zhxA.pdb.gz	Structural basis of allosteric and synergistic activation of AMPK by furan-2-phosphonic derivative C2 binding.
17	PDB:6s73A	0.279	0.814	3.965E-15	269	0.077	0.242	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
18	PDB:5ufuA	0.264	0.567	5.826E-15	369	0.097	0.220	5ufuA.pdb.gz	Activation of Skeletal Muscle AMPK Promotes Glucose Disposal and Glucose Lowering in Non-human Primates and Mice.
19	PDB:4rerA	0.268	0.474	7.668E-15	459	0.092	0.168	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
20	PDB:4rewA	0.259	0.511	1.328E-14	411	0.094	0.192	4rewA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0H2UKW5	0.0	1208	813	0.701	0.723	A0A0H2UKW5_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=ntrk3b PE=3 SV=5
2	A0A0R4ILA2	0.0	840	799	0.517	0.543	A0A0R4ILA2_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=si:ch211-220b11.1 PE=3 SV=1
3	F1QKJ0	0.0	1256	818	0.737	0.756	F1QKJ0_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=trkC1 PE=3 SV=2
4	F6P1M3	0.0	799	797	0.510	0.537	F6P1M3_DANRE Tyrosine-protein kinase receptor OS=Danio rerio OX=7955 GN=trk PE=3 SV=1
5	F7DGW1	0.0	851	838	0.551	0.551	F7DGW1_MACMU Tyrosine-protein kinase receptor OS=Macaca mulatta OX=9544 GN=NTRK2 PE=2 SV=2
6	G9JKB3	0.0	772	576	0.462	0.674	G9JKB3_DANRE Neurotrophic tyrosine kinase receptor type 3a (Fragment) OS=Danio rerio OX=7955 GN=TrkC1 PE=2 SV=1
7	P04629	0.0	741	796	0.479	0.505	NTRK1_HUMAN High affinity nerve growth factor receptor OS=Homo sapiens OX=9606 GN=NTRK1 PE=1 SV=4
8	P15209	0.0	871	821	0.558	0.570	NTRK2_MOUSE BDNF/NT-3 growth factors receptor OS=Mus musculus OX=10090 GN=Ntrk2 PE=1 SV=1
9	P24786	0.0	1629	825	0.945	0.961	NTRK3_PIG NT-3 growth factor receptor OS=Sus scrofa OX=9823 GN=NTRK3 PE=2 SV=1
10	P35739	0.0	725	799	0.468	0.492	NTRK1_RAT High affinity nerve growth factor receptor OS=Rattus norvegicus OX=10116 GN=Ntrk1 PE=1 SV=1
11	Q03351	0.0	1695	864	0.973	0.944	NTRK3_RAT NT-3 growth factor receptor OS=Rattus norvegicus OX=10116 GN=Ntrk3 PE=1 SV=2
12	Q16288	0.0	1749	839	1.000	1.000	NTRK3_HUMAN NT-3 growth factor receptor OS=Homo sapiens OX=9606 GN=NTRK3 PE=1 SV=2
13	Q16620	0.0	860	822	0.548	0.560	NTRK2_HUMAN BDNF/NT-3 growth factors receptor OS=Homo sapiens OX=9606 GN=NTRK2 PE=1 SV=1
14	Q3UFB7	0.0	724	799	0.467	0.491	NTRK1_MOUSE High affinity nerve growth factor receptor OS=Mus musculus OX=10090 GN=Ntrk1 PE=1 SV=2
15	Q548C2	0.0	860	822	0.548	0.560	Q548C2_HUMAN Tyrosine-protein kinase receptor OS=Homo sapiens OX=9606 GN=NTRK2 PE=2 SV=1
16	Q63604	0.0	870	821	0.559	0.571	NTRK2_RAT BDNF/NT-3 growth factors receptor OS=Rattus norvegicus OX=10116 GN=Ntrk2 PE=1 SV=1
17	Q6B515	0.0	809	669	0.484	0.607	Q6B515_TAEGU Tyrosine-protein kinase receptor (Fragment) OS=Taeniopygia guttata OX=59729 PE=2 SV=1
18	Q6VNS1	0.0	1667	825	0.956	0.972	NTRK3_MOUSE NT-3 growth factor receptor OS=Mus musculus OX=10090 GN=Ntrk3 PE=1 SV=1
19	Q91987	0.0	887	818	0.541	0.555	NTRK2_CHICK BDNF/NT-3 growth factors receptor OS=Gallus gallus OX=9031 GN=NTRK2 PE=1 SV=1
20	Q5VWE5	3.06e-80	268	477	0.211	0.371	Q5VWE5_HUMAN Neurotrophic tyrosine kinase, receptor, type 2, isoform CRA_a OS=Homo sapiens OX=9606 GN=NTRK2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	7.7e-05	34.0	CD80-like C2-set immunoglobulin domain
2	PF12330 Haspin_kinase	2.3e+02	12.1	Haspin like kinase domain
3	PF07679 I-set	5e-17	73.1	Immunoglobulin I-set domain
4	PF00047 ig	8.3e-15	66.1	Immunoglobulin domain
5	PF13895 Ig_2	7.7e-08	43.9	Immunoglobulin domain
6	PF13927 Ig_3	3.5e-14	64.4	Immunoglobulin domain
7	PF16920 LRRCT_2	2.8e-16	70.6	Leucine rich repeat C-terminal motif
8	PF01462 LRRNT	0.0031	28.3	Leucine rich repeat N-terminal domain
9	PF12799 LRR_4	0.072	24.8	Leucine Rich repeats (2 copies)
10	PF13306 LRR_5	0.24	22.8	BspA type Leucine rich repeat region (6 copies)
11	PF13516 LRR_6	4.3e+02	12.5	Leucine Rich repeat
12	PF13855 LRR_8	7.8e-10	49.7	Leucine rich repeat
13	PF00069 Pkinase	1.5e-40	150.8	Protein kinase domain
14	PF07714 PK_Tyr_Ser-Thr	1.3e-86	301.7	Protein tyrosine and serine/threonine kinase
15	PF18613 TrkA_TMD	78	14.2	Tyrosine kinase receptor A trans-membrane domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354207

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000397297	0.999	Neurotrophin-3
2	9606.ENSP00000349932	0.998	Receptor-type tyrosine-protein phosphatase S
3	9606.ENSP00000401303	0.990	SHC-transforming protein 1
4	9606.ENSP00000414303	0.985	Brain-derived neurotrophic factor
5	9606.ENSP00000379658	0.976	Transcription factor ETV6
6	9606.ENSP00000358525	0.971	Beta-nerve growth factor
7	9606.ENSP00000304895	0.968	Insulin receptor substrate 1
8	9606.ENSP00000244007	0.967	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
9	9606.ENSP00000172229	0.959	Tumor necrosis factor receptor superfamily member 16
10	9606.ENSP00000407586	0.957	GTPase HRas
11	9606.ENSP00000340944	0.947	Tyrosine-protein phosphatase non-receptor type 11
12	9606.ENSP00000447241	0.945	Fibroblast growth factor receptor substrate 2
13	9606.ENSP00000256707	0.944	Kinase D-interacting substrate of 220 kDa
14	9606.ENSP00000281171	0.942	Receptor-type tyrosine-protein phosphatase O
15	9606.ENSP00000256078	0.941	GTPase KRas
16	9606.ENSP00000256637	0.935	Sortilin
17	9606.ENSP00000376345	0.933	Growth factor receptor-bound protein 2
18	9606.ENSP00000264657	0.928	Signal transducer and activator of transcription 3
19	9606.ENSP00000286827	0.928	T-lymphoma invasion and metastasis-inducing protein 1
20	9606.ENSP00000358548	0.928	GTPase NRas

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004713	0.999	protein tyrosine kinase activity
GO:0004888	0.997	transmembrane signaling receptor activity
GO:0004714	0.983	transmembrane receptor protein tyrosine kinase activity
GO:0019838	0.945	growth factor binding
GO:0005003	0.698	ephrin receptor activity
GO:0004675	0.599	transmembrane receptor protein serine/threonine kinase activity
GO:0005102	0.491	signaling receptor binding
GO:0043121	0.457	neurotrophin binding
GO:0005030	0.427	neurotrophin receptor activity
GO:0019899	0.417	enzyme binding
GO:0002039	0.341	p53 binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0050896	0.987	response to stimulus
GO:0009987	0.985	cellular process
GO:0048518	0.980	positive regulation of biological process
GO:0048856	0.976	anatomical structure development
GO:0048522	0.972	positive regulation of cellular process
GO:0007275	0.966	multicellular organism development
GO:0007154	0.964	cell communication
GO:0048731	0.955	system development
GO:0007399	0.945	nervous system development
GO:0051716	0.938	cellular response to stimulus
GO:0010941	0.936	regulation of cell death
GO:0060255	0.935	regulation of macromolecule metabolic process
GO:0023052	0.933	signaling
GO:0048519	0.930	negative regulation of biological process
GO:0080090	0.921	regulation of primary metabolic process
GO:0060548	0.908	negative regulation of cell death
GO:0051128	0.897	regulation of cellular component organization
GO:0051171	0.896	regulation of nitrogen compound metabolic process
GO:0043067	0.893	regulation of programmed cell death
GO:0007169	0.856	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0065008	0.855	regulation of biological quality
GO:0051239	0.853	regulation of multicellular organismal process
GO:0042981	0.847	regulation of apoptotic process
GO:0031323	0.837	regulation of cellular metabolic process
GO:0051246	0.831	regulation of protein metabolic process
GO:0031399	0.807	regulation of protein modification process
GO:0051960	0.805	regulation of nervous system development
GO:0009719	0.801	response to endogenous stimulus
GO:1902533	0.747	positive regulation of intracellular signal transduction
GO:0071840	0.742	cellular component organization or biogenesis
GO:0051963	0.731	regulation of synapse assembly
GO:0016043	0.730	cellular component organization
GO:0010604	0.726	positive regulation of macromolecule metabolic process
GO:0051173	0.715	positive regulation of nitrogen compound metabolic process
GO:0048468	0.709	cell development
GO:0045937	0.709	positive regulation of phosphate metabolic process
GO:0042327	0.699	positive regulation of phosphorylation
GO:0042221	0.698	response to chemical
GO:0022603	0.698	regulation of anatomical structure morphogenesis
GO:0001934	0.690	positive regulation of protein phosphorylation
GO:1901700	0.684	response to oxygen-containing compound
GO:0010720	0.683	positive regulation of cell development
GO:0031346	0.679	positive regulation of cell projection organization
GO:0010033	0.675	response to organic substance
GO:0051962	0.655	positive regulation of nervous system development
GO:0043069	0.636	negative regulation of programmed cell death
GO:0043066	0.598	negative regulation of apoptotic process
GO:0048513	0.596	animal organ development
GO:0048699	0.576	generation of neurons
GO:0007417	0.567	central nervous system development
GO:0010976	0.546	positive regulation of neuron projection development
GO:0030182	0.543	neuron differentiation
GO:0048666	0.528	neuron development
GO:0050767	0.474	regulation of neurogenesis
GO:0065009	0.466	regulation of molecular function
GO:0010468	0.447	regulation of gene expression
GO:0050790	0.420	regulation of catalytic activity
GO:0044093	0.419	positive regulation of molecular function
GO:0071704	0.417	organic substance metabolic process
GO:0044238	0.409	primary metabolic process
GO:0031175	0.407	neuron projection development
GO:0044237	0.400	cellular metabolic process
GO:0006807	0.376	nitrogen compound metabolic process
GO:0043408	0.371	regulation of MAPK cascade
GO:0033135	0.359	regulation of peptidyl-serine phosphorylation
GO:0033138	0.341	positive regulation of peptidyl-serine phosphorylation
GO:0009892	0.306	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.838	intracellular anatomical structure
GO:0005737	0.770	cytoplasm
GO:0043226	0.751	organelle
GO:0043231	0.724	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	0.999	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]
EC:2.7.10.1	0.983	receptor protein-tyrosine kinase.
RHEA:18673	0.599	ATP + L-seryl-[receptor-protein] = ADP + H(+) + O-phospho-L-seryl-[receptor-protein]
EC:2.7.11.30	0.599	receptor protein serine/threonine kinase.

[back to server]